KEGG   Drosophila mojavensis: Dmoj_GI11723
Entry
Dmoj_GI11723      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K20016  cell death protein hid
Organism
dmo  Drosophila mojavensis
Pathway
dmo04013  MAPK signaling pathway - fly
dmo04214  Apoptosis - fly
dmo04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmoj_GI11723
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmoj_GI11723
   04215 Apoptosis - multiple species
    Dmoj_GI11723
SSDB
Other DBs
NCBI-GeneID: 6582924
NCBI-ProteinID: XP_002008606
FlyBase: FBgn0134482
UniProt: B4L047
LinkDB
Position
Unknown
AA seq 411 aa
MAVPFHLPVEERDDIASSSSGTSNSSGASTSSGASSSSGASDGASSIASQSPNTTSSATQ
TPMQSPLPTDQVLIALCEWYQQHQRHYINSANATAPHIFQYPPPPSPSCSMAQSPSYTGG
DIFFAHGVYVPPPPQHHQQHHQQQHQQQQQAPRTPHTNLSFAGGEELSFFRQPYPAPTTP
QPMPQQPQPTPQSAPPVHYSHSYPQVSHMLQHHPAASYGHPLPAGAYYATYTPPPTPNTA
NASTSTGATGATAVPFGRYGVHGPIMASTPLAPGGPKMRLQRSQSDAARRKRLTSTGEDE
REYQSDHETSWDEFDDRYDNFTAGRERLQEFCGRIPPRKKKTNSSSGNNNANPCSSSSNG
SSNSNSSSNSSANESNYSQQPDKEKEQQSFTWPTVVTVFVLAMGWGLYAAR
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggctgtgccctttcatctgccggtggaggagagagatgacattgcctcgagctcgtcg
ggcacctcgaattcgtcgggcgcatcgacatcatcgggcgcctcctcgtcgtcgggcgcc
tcagatggcgccagcagcatcgcctcccagtcacccaacacaaccagctcggccacgcag
acgccgatgcagtcgccgctgcccacggaccaggttctaatcgccctctgcgaatggtat
cagcagcatcagcgacactacatcaacagtgccaatgccacggccccgcacatctttcag
tatccgccgccgccgagcccctcctgctcaatggcccagtcgcccagctatacgggcggc
gatatattctttgcccatggcgtatacgtgccaccaccgccgcagcaccaccaacagcac
caccaacaacaacaccagcagcagcagcaagcgcctcgcacaccgcacaccaacttgagc
tttgcgggcggggaggagctgagcttcttccggcagccgtatccggcgccgacaacgccg
cagccaatgccacagcaaccgcagccgacgccgcagtcggcgccaccggtgcactacagc
cacagctatccgcaggtctcgcacatgctgcagcaccatccagccgcctcctacggccac
ccgctgccggctggcgcctactacgccacctatacgccgccacccacgccgaacacggcg
aatgcctccacgtcgacgggcgcgactggggcaacggctgtgcccttcggccgctacggc
gtccatggcccaatcatggcatcgacacccctggcgccaggcggacccaagatgcgtctg
cagcgcagccaatcggatgcggccagacgcaaacggctgacctcgacgggcgaggatgag
cgcgagtatcagagcgatcatgagaccagctgggacgagtttgacgatcgctatgacaat
tttacggccggacgcgagcgtctccaggagttctgtggacgcataccgccgcgcaagaag
aagaccaactcgagctcgggcaacaacaatgcgaatccatgcagcagcagcagcaacggc
agcagcaacagcaacagcagtagcaacagcagcgccaatgagagcaactatagccagcag
ccggacaaggagaaggaacaacagagcttcacttggccaacagttgtcaccgtctttgtg
ctcgccatgggctggggcttgtatgcagcgcgatga

DBGET integrated database retrieval system