KEGG   Drosophila mojavensis: Dmoj_GI17540
Entry
Dmoj_GI17540      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
Organism
dmo  Drosophila mojavensis
SSDB
Motif
Pfam: SAM_1 SAM_2
Other DBs
NCBI-GeneID: 6576736
NCBI-ProteinID: XP_002002724
FlyBase: FBgn0140284
UniProt: B4KGH0
LinkDB
Position
Unknown
AA seq 267 aa
MESLSSSSSSSMSSSTCASAISTPKLRRHLDTKSLSISELPDGEDEQDFSFRYPDYMYPD
VEYDKHDVPLSFRATPDSLFSLCAAVVDAQARTEVFKWSINDVAQWLRDFGYPEYEETFR
ENYIDGHKLLNLDAIALVALNIRDFEHIRHLGRGIRALYRKELQTATETKKQSEVYKAFR
SRTGRKYEGLRETELLGRMHMIRSVFQDINEWDLMELHMARTPVRRYREVIAGSRRYNLY
GPSTARRSPITMDDGDTSNWFNFGDCY
NT seq 804 nt   +upstreamnt  +downstreamnt
atggagtcgttgtcctcatcgtcatcgtcgtctatgtcgtcctccacatgcgcgtcggca
atctcaacgccgaaattgcgtcgccatttggacacaaaaagtctcagcatcagtgaattg
ccggatggcgaagatgagcaggattttagctttcgttatccggactatatgtatccggat
gtggagtacgataagcatgatgtgccgctctcgtttcgagccacgcccgattcgctgttc
agtctgtgtgccgctgtcgtggatgcccaggcacggaccgaggtgttcaagtggagcatc
aatgatgttgcccaatggctgcgcgattttggctatccggaatacgaggaaaccttcagg
gagaactatatcgatggacacaagttgctcaatctggatgccattgctctggtggcgctt
aatatacgcgactttgagcacatacgtcaccttggaaggggcatccgagcactctatcgt
aaggagctgcagacggcgacggagacgaaaaaacagagcgaagtctacaaggcgttccgc
tcacgaacgggccgcaaatacgagggcttgcgggagacggagctattgggtcgcatgcac
atgattcgctcggtctttcaggacatcaacgaatgggacctaatggagctgcacatggct
cgcactccggtgcgtcgttatcgtgaggtaatcgccggctcgaggcgctacaatctatac
ggcccatcaacggcacgcagatccccaatcacaatggacgatggcgacacgagcaattgg
tttaattttggcgattgttattga

DBGET integrated database retrieval system