KEGG   Drosophila navojoa: 108652523
Entry
108652523         CDS       T05898                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
dnv  Drosophila navojoa
Pathway
dnv04013  MAPK signaling pathway - fly
dnv04214  Apoptosis - fly
dnv04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    108652523
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108652523
   04215 Apoptosis - multiple species
    108652523
SSDB
Other DBs
NCBI-GeneID: 108652523
NCBI-ProteinID: XP_017958218
LinkDB
Position
Unknown
AA seq 404 aa
MAVPFHLPVEERDDIASSSSGTSNSSSASTSSGASSSSGASDGASSIASQSPNTTSSATQ
TPMQSPLPTDQVLIALCEWYQQHQRHYINSANATAPHIFQYPPPPSPSCSMAQSPSYTGG
DIFFAHGVYVPSPPQHHQQHHQQHHQQQPPRTPHTNLSFAGGEELSFFRQPYPAPTTPQP
MPQQPQPTPQSAPPVHYSHSYPQVSHMLQHHPAASYGHPLPAGAYYATYTPPPTPNTANA
STSTGAAGATAVPFGRYGVHGPIMASTPLAPGGPKMRLQRSQSDAARRKRLTSTGEDERE
YQSDHETSWDEFDDRYDNFTAGRERLQEFCGRIPPRKKKTNSSSGNNNANPCSSSSNSNN
SSGSANESNYSQQPDKEKEQQSFTWPTVFTVFVLAVGWGLYAAR
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggctgtgccctttcatctgccggtggaggagagagatgacattgcctcgagttcgtcg
ggcacctcgaattcgtcgagcgcatcgacatcatcgggcgcctcctcgtcgtcgggcgcc
tcagatggcgccagcagcatcgcctcccagtcacccaatacaaccagctcggccacgcag
acgccgatgcagtcgccgctgcccacggaccaggttctaatcgccctctgcgagtggtat
cagcagcatcagcgacactacatcaacagtgccaatgccacggcgccgcacatctttcag
tatccgccgccgccgagcccctcctgctcgatggcccagtcgcccagctatacgggcggc
gatatattctttgcccatggcgtttacgtgccatcaccgccgcagcaccaccaacagcac
caccagcagcaccaccaacagcaaccgcctcgcacaccgcacaccaacttgagctttgcg
ggcggggaggagctgagcttcttccggcagccgtatccggcgccgacaacgccgcagcca
atgccacagcaaccgcagccgacgccgcagtcggcgccgccggtgcactatagccacagc
tatccgcaggtctcgcacatgctgcagcaccatccagccgcctcctacggccacccgctg
ccggctggcgcctactacgccacctatacgccgccacccacgccgaatacggcgaatgcc
tccacgtcgacgggcgcggctggggcaacggctgtgcccttcggccgctacggcgtccat
ggcccaatcatggcatcgacacccttggcgccaggcggacccaagatgcgtctgcagcgc
agccaatcggatgcggccagacgcaaacggctgacctcaacgggcgaggatgagcgcgag
tatcagagcgatcatgagaccagctgggacgagtttgacgatcgctatgacaactttacg
gccggacgcgagcgtctccaggagttctgtggacgcataccgccgcgcaagaagaagacc
aactcgagttcgggcaacaacaatgcgaatccatgcagcagcagcagcaacagcaacaac
agcagcggcagcgccaatgagagcaactacagccagcagccggacaaggagaaggagcaa
cagagcttcacttggcccacagttttcaccgtctttgtgctcgccgtgggctggggcctg
tatgcagcgcgatga

DBGET integrated database retrieval system