KEGG   Drosophila navojoa: 108654139
Entry
108654139         CDS       T05898                                 

Definition
(RefSeq) caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dnv  Drosophila navojoa
Pathway
dnv04214  Apoptosis - fly
dnv04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108654139
   04215 Apoptosis - multiple species
    108654139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dnv01002]
    108654139
Enzymes [BR:dnv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     108654139
Peptidases and inhibitors [BR:dnv01002]
 Cysteine peptidases
  Family C14: caspase family
   108654139
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 108654139
NCBI-ProteinID: XP_017960722
LinkDB
Position
Unknown
AA seq 318 aa
MTDEWKIRSFGSHDLDSGKINNNADTIDAKGEASANSKRSGGEANAVAPPINKYVARMTT
DRYAKEYNMNHKHRGQALIFNHENFTIPYLSTRRGTNVDSEQLSKALERLGFEVTVHKDC
ILSEILDVVSKTAAKDHTDNDCIVIAVMSHGEHGHLYAKDVQYRLDSIWTYFTANNCPTL
AGKPKLFFIQACQGDKLDPGSTMVKETETDGDSSTSYKIPTHADFLFSYSTIPGYFSWRN
TDNGSWYIQSLIKELNENGKEYNMLTLLTFVSQRVAVDYESNVPSNPLMDRQKQIPCVTS
MLTRILRFNDKPPYSQAG
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacggacgaatggaaaattagatcctttggctctcacgaccttgacagcgggaaaata
aacaacaatgctgataccatcgacgcaaaaggagaagcgagcgcaaattctaagcgaagc
ggtggtgaagccaatgccgtcgcacccccaataaataaatatgtcgctcgaatgactacc
gaccgatacgctaaggaatataatatgaatcataagcaccggggacaggccctcatcttc
aatcacgaaaattttactataccctatctgtcaacgcgtcgaggcaccaatgtggacagc
gaacagctatctaaagccctggaacgtctaggtttcgaggtgactgtacacaaggattgc
atcctgagcgagattctggatgttgtaagcaagactgctgccaaggatcacactgacaat
gattgcatagtgattgcggtgatgtcccatggcgagcacggtcacctctatgccaaagat
gttcaatacaggctggacagcatctggacctattttaccgctaacaattgccccacgcta
gctggtaaaccaaagttattcttcatacaggcctgtcagggtgataaacttgatccgggc
tcgacgatggtaaaggaaacggaaacggatggcgattcctcgacgagctacaaaatacct
acacatgccgactttttattctcatattcaacaatcccaggatacttttcgtggcgcaac
actgataacggctcatggtacattcagtcgctcataaaggagctcaatgaaaatggaaag
gaatacaatatgctcacattgctgactttcgttagccaacgtgtggccgtcgattacgaa
tcgaacgtgccatcgaatccgttgatggatcgtcagaagcaaattccatgtgtgacgtca
atgttgacgcgcattttgcgctttaatgacaaacccccttacagccaggcaggctaa

DBGET integrated database retrieval system