KEGG   Drosophila navojoa: 108658095
Entry
108658095         CDS       T05898                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dnv  Drosophila navojoa
Pathway
dnv00230  Purine metabolism
dnv01100  Metabolic pathways
dnv04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dnv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108658095
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108658095
Enzymes [BR:dnv01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108658095
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNF-1_N
Other DBs
NCBI-GeneID: 108658095
NCBI-ProteinID: XP_030243838
LinkDB
Position
Unknown
AA seq 1170 aa
MPEEKAANLENGQTTAASTPSKTKRQRTPTRRRPPNESDVVAGGVGITGGGVVILPQHVL
NELYHNYSIKQRRSGLKWFLFAAVLFNLWTICIPWEQAFLTRVVNCSMLLAYLALTALLH
IGRQSEQPALRRFHHSLLTIVPRALWFLSMLHFAAYVMLQASFSPRDVLGWAILLNFLIY
VTLPLPLIFLGLVIGFCTYFNCLSLPVGFSRPDPLISDQAAANAVLIATAALIGLLYYFM
GEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKI
YMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCY
YCISGAPDERPDHAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQW
QFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAGLKTY
FITKVVKPFASPCGKKINESKPENTNHSPDSNPSSNSSNESNECAGDDNDATVDDEELLA
QSVVINGHNPTAAEDEEEQIKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNPQLEQA
YAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVAISIAESF
SGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHIVSESEFN
ATGGLEEVATAEHLLPESFVEQMREAVPTERVLYPSYLSNFSVLILIAIAVIAQLTHLTK
ILLLLSIAALHCYFNVCIMQDLYILEDDLAHQPLISTRYCASGLLLVAALSLSFLARHMD
HEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYA
EVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGST
YMAASGINLQRNLRTDAPITERWSHLAVLVEFALELKHALQGINEQSFNHFVLKMGINHG
PITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAVQVTEETCNILQQFGYTFQQRGLVA
VKGKGQLMTYYLQGKTESSAAEAKAAVELHEKETVATAAPVPVSLECSAELEADIKTPLL
KLKAQDAATEAAAESCLGNGNVAESQSLLE
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgccggaagagaaggcagcaaatctcgagaatggccaaacaacggcagcatccacgccc
agtaaaaccaaacgtcaaaggacaccaacacgtcgacgtccgccaaacgagagcgacgtc
gtcgctgggggcgtgggcattaccggcggcggtgtggtcatcctgccccagcatgtgctc
aacgaactctatcacaactattccattaaacagcgacgcagcggccttaagtggttcctg
tttgcggccgtgctctttaatctctggacgatttgcataccctgggagcaggcgtttctc
acaagagtggtcaactgcagcatgctgttggcctatttggcgctgacggctctgctgcac
attggacgccagtcggagcagccagccctgagacgcttccatcattcgctgttgacaatt
gtgccgcgagccttgtggttcctctcgatgctgcatttcgccgcctatgtgatgctgcag
gccagcttctcgccgcgagatgttcttggctgggcgattctcttgaacttcctaatatat
gtgacattgccattgccgttgatttttttgggtctggtaattggcttttgcacgtacttc
aattgcttgagtctgcccgttggcttctcacgtccagatcctttaatctcagatcaggcg
gcggctaatgccgttttaatagccaccgcagcgttaattggccttttatattacttcatg
ggcgaggcgaagcagaaacgcgccttcctggaggccaaaaagagtctggaggtgaagatg
gtcattgaggagcagtcggcagagcaggaacgtttgctgctatccgtgctgcccaagcat
gtagctatcaagatgcgcgaagacctgggctcatctagttcagaggccttcaaaaagatc
tacatgagtcgacatgagaatgtgagcatactgtatgcggatattgtcggctttaccgcc
atctcctcgacgtatagcgcccaagatctggtaaaaatgctaaacgagctcttcgcacgc
ttcgataggctcgccgagaagtaccaacagctgcgcattaaaattctcggtgattgttat
tattgcattagcggagcgcccgacgagcggccggatcatgccgtgctctgcgttcacatg
ggactttccatggtgaaggccatcaaatatgtgcagcaaaaggcaaactcacctgttgat
atgcgtgtgggcatacacacgggcgctgtcctggccgggatactgggccagcgtcaatgg
cagtttgacgtttactccaaggacgttgagctggccaataaaatggagtccagcggcaaa
gccggacgtgtacacatttccgacaaaacattggcctttctcaatggcgaattcgaggtg
gagccggcctttggcgagaagcgggaggagctgctgcgcatagctggcctgaagacatat
tttataacgaaagtggttaaaccgttcgcctcgccctgcggcaagaaaatcaacgaatcg
aagcctgagaacaccaatcacagtcccgactcgaatcccagcagcaacagcagcaacgag
agcaacgaatgcgctggcgatgacaacgatgccacagtcgatgacgaggagctcttagca
caaagtgtcgtcatcaatggacacaatcccacagccgccgaggatgaggaggagcaaata
aagctggagaatttcaagcaacgtttaaaagatgagctggtcacacgcgacggtcacgaa
aatctcaccaaggacacaaacatctttttgcgcttcaagaatccgcaactggagcaagcc
tacgccgtctatcgggagccgtacagctcgctgcccttgctggccgccctgctggtgcag
tgcatcgatgttttgtactcctatttggtgttgccgcgctcaacgctgcattttataaac
attgctgcgccgctggtgcccatcgccatgctggtggcgattagcattgccgaaagcttt
agcggcatgctgcccaagttcttcgtggatgtgagcaagcgtttcaatgacattaccttc
gtacgggagctggcggccataattatagcacttaccattggcctcagcaatgtcatcgac
atgtttttctttgtcaccttcgtgcgcaccgagcacattgttagcgagagtgaattcaat
gccacgggcggcctagaggaggtggccaccgccgagcacctgctgcctgaatcgtttgtg
gaacagatgcgtgaagcggtgcccaccgagcgtgtcctatatccgtcctatttgagcaac
ttcagtgtcctcatactaatcgccattgctgtaattgcacagctcacgcacttgaccaaa
atcctgttgctcttgtccattgcagctctgcattgctatttcaatgtgtgcattatgcag
gatttgtacattctggaggatgatctggcacaccagcctctcatatcaacgcgttattgt
gcttcaggtctgcttcttgtggcggcactgtcactcagctttttggcaagacatatggac
cacgaggatcgtgttatattcaaatggaaaactgaggtcgccgagcagaaggaaaccgcc
aacgatatgcgtcagcgcaacgaggctttggtctataatgtgctgcccgtgcatgtggcc
gagcatttcatgaagaacacaaagcgctcccacgacgatctctactcgcagagctatgcc
gaggtgggcgtgctcttcgccagcatgccaaacttttcagatttttattcggaggaaacc
gttaacaatcagggcctggaatgcttgcgttttctgaatgaagtcatttccgatttcgat
gcgctattggagctaccacagtttcaggacatcattaagataaagacaattggatcaact
tatatggcagccagtggcattaatttgcagcgcaatttacgcactgatgcgcccattacc
gagcgctggtcccacttggcggttctggtggaattcgcactggagctaaagcacgcactg
cagggcatcaatgagcagtcattcaatcatttcgtactcaaaatgggcatcaatcatgga
ccgataacggcgggcgtgattggcgcccggaagccacactacgatatctgggggaatacg
gtgaatgtggcctccagaatggagagcaccggtaaagcgggtgccgtgcaggtcaccgag
gagacctgtaacatattgcagcagttcggatatacgtttcagcagcgcggactggtggct
gtaaagggcaagggccagctgatgacctactatttgcagggcaaaactgagagcagcgct
gcggaggcaaaggcagccgttgagctgcatgagaaggagacggtggccacggcagctcca
gtgccagttagtttggagtgcagcgccgagctagaagcagacataaagacaccactgctt
aagcttaaggcacaggatgcagcaacggaagccgcggcagaatcatgtttgggcaatggc
aatgttgcggaatctcaatccttgttggagtga

DBGET integrated database retrieval system