Diuraphis noxia (Russian wheat aphid): 107167928 Help Entry 107167928         CDS       T04900                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism dnx  Diuraphis noxia (Russian wheat aphid) Pathway dnx03010   Ribosome dnx04120   Ubiquitin mediated proteolysis dnx04137   Mitophagy - animal dnx04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:dnx00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     107167928   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     107167928  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107167928    04137 Mitophagy - animal     107167928  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:dnx03011]     107167928    04121 Ubiquitin system [BR:dnx04121]     107167928   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dnx04147]     107167928 Ribosome [BR:dnx03011]  Ribosomal proteins   Eukaryotes    Small subunit     107167928   Archaea     107167928 Ubiquitin system [BR:dnx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    107167928 Exosome [BR:dnx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107167928   Exosomal proteins of colorectal cancer cells    107167928 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Plexin_RBD Dsc3_N Ubiquitin_5 DUF2604 TBK1_ULD Motif Other DBs NCBI-GeneID:  107167928 NCBI-ProteinID:  XP_015372630 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MQIFVKTLTGKTITLEVESSDSIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKKRKIKLAVLKFYKVDENGKVIRLKKE CTSENCGPGVFMADMPNRHYCGKCSATVPK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagacgttgactgggaaaacgatcactctcgaagtagagtcgtcg gattcaattgaaaatgtgaaatctaaaattcaagataaagaaggtattccacctgatcag caacgtttgatatttgctggcaaacaacttgaagatgggcgtactctgtcagattacaac attcaaaaagaatctaccctccacttggttcttagactgagaggtggtgctaagaaacgt aagaagaagaattattctacacccaaaaagatcaagcacaagaaaaggaagattaagttg gctgtgttaaaattttacaaagttgacgaaaatggtaaggttatccgtttgaagaaagaa tgtacttctgaaaactgtggtccaggagtgttcatggctgacatgccaaacaggcattat tgtggcaaatgttctgctactgttccaaagtag

DBGET integrated database retrieval system