KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0277800-01Help
Entry
Os09t0277800-01   CDS       T02163                                 

Gene name
Os09g0277800
Definition
(RAP-DB) Similar to Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplast precursor (EC 1.3.1.9) (NADH-dependent enoyl-ACP reductase).
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00061  Fatty acid biosynthesis
dosa00780  Biotin metabolism
dosa01100  Metabolic pathways
dosa01212  Fatty acid metabolism
Module
dosa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Os09t0277800-01 (Os09g0277800)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Os09t0277800-01 (Os09g0277800)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Os09t0277800-01 (Os09g0277800)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dosa01004]
    Os09t0277800-01 (Os09g0277800)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Os09t0277800-01 (Os09g0277800)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Os09t0277800-01 (Os09g0277800)
Lipid biosynthesis proteins [BR:dosa01004]
 Fatty acid synthase
  Component type
   Os09t0277800-01 (Os09g0277800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
RAP-DB: Os09t0277800-01
LinkDB All DBs
Position
chr09:join(5782535..5782772,5783232..5783341,5783419..5783474,5783584..5783668,5783738..5783785,5783911..5783985,5784081..5784192,5784638..5784689,5784767..5784818,5784917..5784974,5785217..5785315,5785407..5785537)
AA seq 371 aa AA seqDB search
MGASVTTGLQMAAARPCIPACQRLLGSRAALPSFGRALSTQTGFASCRKTASAGPFVSLN
HKRFAVRAMSAQGLPIDLRGKRAFIAGVADDNGYGWAIAKALAAAGAEILVGTWVPALNI
FETSLRRGKFDESRKLPDGSLMEITKVYPLDAVFDSPEDVPDDVKANKRYAGSSNWTVKE
VAETVKNDFGTIDILVHSLANGPEVKNSLLETSRKGYLAAVSASSYSFISLLQHFLPIMN
PGGATISLTYIASERTIPGYGGGMSSAKAALESDTRVLAYEAGRKGKIRVNTISAGPLGS
RAAKAIGFIEKMIEYSYVNAPLQKELLADEVGNTAAFLASPLASAITGSTIYVDNGLNTM
GLALDSPTLST
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcatcagtgactactggcttgcagatggcggcggcacgcccttgtatcccagct
tgccaacgcctgctagggtcaagagcagcacttccttcatttggaagggcgcttagtacc
caaactggcttcgcgagctgcagaaaaacagcatcagcagggccgtttgtttctctgaac
cacaagaggtttgccgtgagggcgatgtctgcccagggactccccattgatctcagaggt
aaaagagcatttattgctggagttgctgatgataatggctatggctgggcaatagcaaaa
gctcttgctgcagctggtgccgagattcttgttggtacatgggtacctgcactgaacata
tttgagacaagcttgaggcgtgggaagtttgacgaatcacgaaagcttcctgatggatct
cttatggagattacaaaagtctacccattggatgcagtttttgactctcctgaggatgtt
cctgatgatgttaaagcaaacaaaaggtatgctggatcttcaaactggactgttaaggaa
gttgctgaaactgtgaagaatgactttggtaccattgacatcctcgtacactctcttgca
aatggtcctgaggtaaaaaactctttgctggagacatcaagaaaagggtatcttgctgca
gtttcagcatctagttactctttcatctctttactccaacacttccttcctataatgaat
ccagggggtgctactatatccttgacctacatagcttccgaaaggacaattcctggatac
ggtggcggcatgagctcagcaaaagcagcacttgagagtgatacaagagttctagcttac
gaagcaggtcgaaaaggcaagatcagagtgaataccatatcagcaggtccattgggaagt
cgagcagccaaagctattggtttcatcgagaagatgatagagtattcgtacgtgaacgca
ccactgcagaaggagctcttggcagatgaagtggggaacacagcagcattcttagcatcg
ccgttggcatctgcaatcactggatcaactatctatgttgacaatgggctcaatacaatg
ggacttgcacttgacagccctacactatccacatag

DBGET integrated database retrieval system