KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0489200-01Help
Entry
Os10t0489200-01   CDS       T02163                                 

Gene name
Os10g0489200
Definition
(RAP-DB) Similar to DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide synthase [ATP]).
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03030  DNA replication
dosa03410  Base excision repair
dosa03420  Nucleotide excision repair
dosa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Os10t0489200-01 (Os10g0489200)
   03410 Base excision repair
    Os10t0489200-01 (Os10g0489200)
   03420 Nucleotide excision repair
    Os10t0489200-01 (Os10g0489200)
   03430 Mismatch repair
    Os10t0489200-01 (Os10g0489200)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dosa03032]
    Os10t0489200-01 (Os10g0489200)
   03400 DNA repair and recombination proteins [BR:dosa03400]
    Os10t0489200-01 (Os10g0489200)
Enzymes [BR:dosa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Os10t0489200-01 (Os10g0489200)
    6.5.1.6  DNA ligase (ATP or NAD+)
     Os10t0489200-01 (Os10g0489200)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Os10t0489200-01 (Os10g0489200)
DNA replication proteins [BR:dosa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Os10t0489200-01 (Os10g0489200)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Os10t0489200-01 (Os10g0489200)
DNA repair and recombination proteins [BR:dosa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Os10t0489200-01 (Os10g0489200)
   NER (nucleotide excision repair)
    Other NER factors
     Os10t0489200-01 (Os10g0489200)
   MMR (mismatch excision repair)
    Other MMR factors
     Os10t0489200-01 (Os10g0489200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase eIF-3c_N TrmB
Motif
Other DBs
RAP-DB: Os10t0489200-01
LinkDB All DBs
Position
chr10:complement(join(18558482..18559645,18558272..18558388,18557946..18558047,18557748..18557861,18556974..18557204,18556798..18556892,18556337..18556424,18555990..18556121,18555559..18555671,18555042..18555143,18554790..18554851,18554605..18554676,18554457..18554530,18554350..18554370))
AA seq 828 aa AA seqDB search
MFLLRATATSTSTAASAAAASLLLRCHHPLSPPPRTLALALPARPPPALLLPSRFRLSSS
ASSSSRRRATGAASASAGAGAGKGKGKGGKSSGGKAAAAAAAGGAAMSASAGGGGGGGGK
RTVADVLMGNARDAARKAKKGAAPSPKKLKTQPQPAAEADGGAVAKPEEKPHSPVKPKRS
SSPTKSNSPGEGKRSESVAAGAKPEAKEKPSPKKPKTLGAKSDTKSSAEGVEKEKRRSPS
PTKAKALASESQDIKKPSSPKKTKALDAPKSEEKDTTLELKKKGSEFNPMAAAYWSPEEP
VPFLFLARALDLISNESGRIVITEILSNVFRTVIATTPEDLLATVYLSANRIAPPHEGTE
LGIGDASIIRALAEAYGRREEHVKKNLKELGDLGLVAKASRLSQKMMYKPKPLTISHVLA
KFRTIAKESGKDSQDKKRNHIKGLLVAATDCEPQYITRLLQSKMRIGLAEKTVQMALGQA
AVYSEKHSPPSKIQSPFEEAAKIIKQVYSVLPIYDKIVPAILEVGVWKLPEICSFSIGVP
VGPMLAKATKSVSEIIDKFQGLEYTCEYKYDGERAQIHCLEDGSVEIYSRNAERNTGKYP
DVVDAVSRFRKPTVKSFVLDCEIVAYDREKKKILPFQILSTRARKGVTISDIKVSVCTFG
FDILYINGKPLLQEQLKVRREHLYNSFEEVPGVFQLATSITSNDLEEIQKFLDTAVNSSC
EGLIIKTLDKDATYEPAKRSNNWLKLKKDYMDSIGDSLDLVPIAAFHGRGKRTGVYGSFL
LACYDEQNEEYQTICNIGTGFSEQQLEERSVSLRTKAIPKPKLCFHFF
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcctccgcgccaccgccacctccacctccaccgccgcctccgccgccgccgcc
tcgctcctcctccgatgccaccacccgctctccccgccgcctagaaccctagccctcgcc
ctccccgctcgccctccccccgccctcctcctcccctcccgcttccgcctctcctcctcc
gcgtcctcctcctcccgacgccgcgcgaccggtgccgcatccgcatccgcgggcgcgggc
gcggggaaggggaaggggaaggggggcaagtccagcggggggaaggcggcggccgcggcg
gcggcgggaggagcggccatgtcggcctcggcgggtgggggtggaggtgggggagggaag
cggacggtggcggatgtgctgatggggaacgcgcgggacgcggcgaggaaggcgaagaag
ggggcggcgccgtcgccgaagaagctgaagacgcagccccagcccgccgcggaggcggat
ggcggcgcggtggcgaagccggaggagaagccgcattcgccggtgaagcccaagcggtcg
tcctcgccgactaagtccaactcgccaggtgaggggaagaggtccgaatcggtggctgct
ggcgcgaaaccggaggcgaaggagaagccctcgccgaagaagcctaaaaccctaggtgcc
aaatccgacaccaagtcctccgcggaaggcgttgagaaggagaagaggaggtcaccatct
ccgacgaaggcaaaagcgctagcttctgaatcccaggacataaagaagccctcctcacct
aagaagaccaaagccttggatgcccccaagtctgaggaaaaggacaccaccctcgagctc
aagaagaagggcagtgaattcaatcccatggctgctgcttattggagccccgaggagccc
gtgccgttcctgttcctcgctcgggcacttgacctcatctctaatgagtctggaaggatt
gttatcacggagatcctatcgaatgtattccgcacggtgattgccacaacaccagaggat
ctcctcgcgacagtatacctctcagccaaccggattgcgccgcctcatgaagggactgaa
cttggaattggggatgcatcaattatccgtgcacttgcggaggcatacggccgcagagag
gagcatgtcaagaagaacctaaaggagttgggcgatttggggcttgttgcaaaagcaagc
aggttgtcacagaagatgatgtacaaaccgaaaccactgacgatctcacatgtacttgca
aaattccggacaattgcaaaggaatcaggcaaagatagtcaagataagaaaagaaatcat
atcaaaggacttctcgttgccgcaactgactgtgaacctcaatacattacacgactactt
cagtcgaagatgaggattgggttagcagaaaaaaccgtccagatggctcttgggcaagct
gctgtgtattctgaaaaacattctccaccgtcaaaaatccaatccccttttgaagaggct
gcaaaaataattaaacaagtatattcagttcttccaatatacgataaaattgtcccagct
attctagaagttggtgtttggaaacttccagagatatgcagtttttctattggtgttcct
gttggtcctatgttggcaaaagcaacaaagtctgtctcagagatcatagacaaatttcag
ggtcttgagtacacttgtgagtacaagtatgatggtgaacgggctcagatacattgcctg
gaagatggatcagtagagatctatagtcgtaatgctgagaggaacactgggaagtatcct
gatgttgttgatgcggtttctagattccggaagcctacagtcaaatcatttgtcttggac
tgtgaaattgttgcttatgaccgtgaaaagaagaaaatattaccttttcagatacttagc
acacgggcccgcaagggtgttaccataagtgatatcaaagtgtcagtctgtacttttggc
tttgatattctttacatcaatggcaagcctcttctccaggaacaactgaaagttcgacga
gagcatctttacaactcctttgaggaagtaccaggtgtttttcaattggcaacttcaatt
acatcaaatgacctcgaggagatacaaaaatttcttgacacagctgtcaactccagttgt
gaagggttgattatcaagacattggataaggatgctacatatgagccagcaaaacgatcg
aacaattggttgaaattgaagaaagactacatggacagcattggagactctttggatttg
gtgccaattgctgcctttcatgggagaggaaaacgtacaggtgtatatggatcattcctc
ctggcatgttacgatgagcagaacgaagaataccaaacaatctgcaacataggcactgga
ttttctgagcaacagcttgaggagcgttctgtgagccttcgaactaaagcaataccaaaa
ccaaagttgtgctttcattttttttag

DBGET integrated database retrieval system