KEGG   Dendroctonus ponderosae (mountain pine beetle): 109538429Help
Entry
109538429         CDS       T04899                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dpa  Dendroctonus ponderosae (mountain pine beetle)
Pathway
dpa04146  Peroxisome
dpa04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109538429
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109538429
Enzymes [BR:dpa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109538429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 109538429
NCBI-ProteinID: XP_019761213
UniProt: J3JYL1
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MVKAVAVLKSEVVNGTVFFSQEGNNPVQVNGSLSGLKEGLHGFHIHEFGDNTNGCISAGP
HFNPNDKEHGGPTDADRHAGDLGNIEANAEGVAKINITDKQISLSGANSIIGRTVVVHAD
PDDLGKGGHELSKTTGNAGGRLACAVIGLAQPN
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagccgttgccgtgttgaaaagcgaagtggtcaatggaaccgtcttcttttcc
caggaaggcaacaatccggtgcaggtaaatggatcgctgagcggtctcaaagaaggcctg
catggattccacattcatgaattcggggacaacaccaatggctgcatatcagccgggccc
catttcaaccccaacgacaaggaacatggaggcccaactgacgctgaccgtcatgctgga
gatttaggaaacattgaggccaatgctgaaggagtcgctaagatcaacatcacggacaag
cagatttcgttgagtggagcgaacagcattattggacgcacagttgttgtgcatgcagac
cctgatgatttgggcaaggggggacatgagctgagcaaaaccactggcaatgctggtggc
aggttggcctgtgcagttattggccttgcacagcccaactag

DBGET integrated database retrieval system