KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_306567Help
Entry
DAPPUDRAFT_306567 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00052  Galactose metabolism
dpx00500  Starch and sucrose metabolism
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DAPPUDRAFT_306567
   00500 Starch and sucrose metabolism
    DAPPUDRAFT_306567
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DAPPUDRAFT_306567
    3.2.1.20  alpha-glucosidase
     DAPPUDRAFT_306567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2
Motif
Other DBs
NCBI-ProteinID: EFX87691
JGI: Dappu1_306567
UniProt: E9FYY6
LinkDB All DBs
Position
Unknown
AA seq 721 aa AA seqDB search
MITFALPSPYLYGIGENTHDSFVHNLEYKMHPIFARDQPPGDGEMNLYGSHPFYMVSEDD
GSSHGVFLFNSHAIDVTTLPYPGLTYRTIGGGLDFFVFLGPKPEDVVKQYTEIIGRTMMP
AYWSLGFQLSRYGYNGTSEIREVVERTRNALIPQDVQYADIDYMDNQADFTLGPNFLDLP
DFVIEQAVGGLRFIPILDPAINTEKVNINYTTHTNAMDVGAYITWYNDTLQPDGNCTTSS
SNSFPDFFKSETQGWWKQELKIFHDKLSYDGIWIDMNEPAAFDTNKEKPFNYPPELPPWN
LICPENEWDDPPYITLSASRSATKRLSDKTICMVGRQGQNNEHLHYAVHNLYGWSQTKPT
YEGLQSATGKRGIVITRSTFPSSGKHAGHWLGDNTSRWKDLHSSIIGSLEFNLFGIPYIG
ADICGFFETTTEELCARWMELGAFYPFSRNHNSLNVPPQDPAIWPSVASASKTALNIRYR
LLPYLYTLFYHSHTTGSTVVRPLYHEYPTDLRAKSVDTQFLWGPALLISPVLIEKTTELK
AYLPSDTWFDYYTGKKEATSGTEVTWNTPLEKINLHVRGGYILPQQIEGLNTKLSRQNNF
TMIVALNSDNAAAGDLFWDDGETINTVTNHQYYYIRFSYAETLNNDIAVEGVLTMEVQTN
TTSLTGLENLKMDSMSIFGLSKAPTSVDTGDVSYYPDNNVAYLTNLNRPMISNWKVVLHF
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgatcacctttgccctaccgagtccgtacctgtacggtatcggagaaaatactcacgat
tccttcgttcacaatttggaatataaaatgcaccccatttttgctcgcgatcagccgcca
ggagacggagaaatgaacctctacggctctcatccattttacatggtgagcgaagacgac
ggatcatcccacggcgtctttttgtttaacagccacgcaattgacgtcacgacgttaccg
taccctggactaacttatcgcactatcggtggcggcttggatttcttcgtcttcctcggc
cctaaacctgaagacgttgtcaagcaatacactgaaattattggacgaacaatgatgcct
gcttactggtctttaggatttcaattaagtcgttacggatacaacggaacaagcgaaatc
cgggaagtggttgaacggacacgtaacgccttaattcctcaagatgtccagtatgccgat
atcgattatatggacaatcaagccgacttcacattagggcccaatttcctagatttgcct
gatttcgtgatagagcaggcggtgggtggacttcgcttcattcctattctcgacccagca
atcaacaccgagaaagtgaatattaattacactactcacaccaacgctatggatgtagga
gcttacatcacatggtacaatgatactttgcaacctgacggaaattgcaccactagctct
tcaaactcgtttcccgattttttcaagagcgaaactcaaggctggtggaaacaagaattg
aaaattttccacgataaactatcctatgatggaatatggattgacatgaatgagccagcc
gccttcgatactaataaggaaaaacccttcaactatcctcccgaattaccaccatggaac
ttgatttgccctgaaaatgaatgggacgatccgccatatattacactgtctgcttcccga
tccgctacgaaacgcctttcggacaaaaccatttgtatggtgggtcgccaaggacaaaac
aacgaacatctacattacgccgttcataatctctatggatggagtcaaactaaaccgaca
tacgaaggattgcaaagcgccaccggtaagagaggtatcgtcattacaagatctacattc
ccaagttctggaaaacatgctggacactggctaggtgacaatacttcacgttggaaggac
ttgcacagctcaattattggaagtctcgaatttaatctttttggcataccatacatcgga
gctgatatttgcggattttttgaaacaacaactgaagaactgtgtgcacgctggatggaa
ctgggggcattctatccattctcacgcaatcacaactcacttaacgtgcccccacaagac
ccagccatttggccatcagttgctagcgcatccaaaactgctctcaacatacgttaccgc
cttttaccctatctttacaccctgttctaccacagccacactacaggatcaacagttgtt
cggcctctctaccacgagtatccaactgacctacgagctaaatctgtcgatactcagttt
ctttggggacccgctttactcatatcccccgtcttgatcgaaaagacaaccgaactaaaa
gcatacctgcccagtgacacctggtttgactattataccggaaagaaagaagcgacttca
ggcacagaggtcacttggaatacaccgctcgagaaaatcaatcttcacgtgcgtggtggt
tacattttaccacagcaaatcgaaggattgaacaccaagctcagtcgtcaaaacaatttc
acaatgatcgtcgctctaaattcggacaacgcagctgccggcgatttgttttgggacgac
ggcgaaaccatcaacaccgtcaccaatcatcaatattattacattcgtttcagttacgcg
gaaaccctaaacaacgacattgctgtagagggtgtgctgactatggaggtacaaactaac
accactagccttacgggattggaaaatctcaaaatggattcaatgtcaatttttggactc
agtaaagctccaacttctgtcgataccggagatgtaagttactaccccgacaacaacgtg
gcctaccttaccaatcttaatcggccaatgatatccaattggaaagttgttctacatttt
gactag

DBGET integrated database retrieval system