KEGG   Dinoponera quadriceps: 106750545
Entry
106750545         CDS       T05610                                 

Definition
(RefSeq) uncharacterized protein LOC106750545 isoform X1
  KO
K16679  wengen
Organism
dqu  Dinoponera quadriceps
Pathway
dqu04013  MAPK signaling pathway - fly
dqu04214  Apoptosis - fly
dqu04215  Apoptosis - multiple species
dqu04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    106750545
   04391 Hippo signaling pathway - fly
    106750545
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    106750545
   04215 Apoptosis - multiple species
    106750545
SSDB
Motif
Pfam: TNFR_c6 Trp_oprn_chp
Other DBs
NCBI-GeneID: 106750545
NCBI-ProteinID: XP_014486448
UniProt: A0A6P3Y7V9
LinkDB
Position
Unknown
AA seq 407 aa
MCAGVSKTVRSETVHKSLLSFLQKSGRDTRNRCRRLYSSVLQQVIRVLCDVVAIRERLSL
GAAPRSPPLSRRLRRLGLHHDRLDSTEGSVMPRESCRGLLLTLVSVFVGLCESADAISGA
QHPVCKPGLEFWSTDRGSCWPCTRCDPEFTLSTCSVHKDTICGPLSALELDWSFLSTRKR
PEAVQRRFEAVTSKMLWQLPEPTDERREQLHEEAGDLVGLNHEDSGLLDDEQPISASQES
KEAHDPRERRKSTNLDNLPWDWQTGALVLAVCACIVFFLVAGCSALVYARQWRRMKRNFE
PAGLEEISARLNLMVKAELAELVAGAPMNPGDPETRCQYLEKLLDRKRETPVVAAAAAAA
AAASWPVEAGGNLYIEEGGTPRSKRSQIARIQRNIETILSHKTNGAD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtgtgccggtgtatcgaagacagtccgcagcgaaactgtacataagagtttactttcc
ttcctccaaaagtccggtcgagatacgcgaaaccgttgtcgccgattgtacagttcagtg
cttcaacaggtcatccgcgtgctgtgcgacgtagtggcgatccgcgaaagattatcactc
ggggctgcaccgcgctcgcctcctctttctcgtcggctgcgtcgcctcggattacatcat
gacagactcgactccaccgaaggcagcgtgatgccgagggaatcctgtcgggggttgctg
ttgaccctggtgtcggtattcgtcggcctgtgcgaatccgccgacgcgatatccggcgca
cagcatccggtctgcaagccgggcctggaattctggtccacggatcgcggctcctgctgg
ccatgcacccgatgcgaccccgagttcacgctgagcacgtgttcggtgcacaaggatacg
atttgcggcccgctgtcggcactggagctcgactggtcctttttgtcgaccaggaaaagg
ccggaggccgtgcaacgtcgcttcgaggccgtcacctcaaagatgctctggcagttgccc
gaaccgacagacgagcggcgagaacaacttcacgaagaagccggtgatctcgtcggtctc
aaccacgaggacagtggcctcttggacgacgaacagccaatctccgcttcgcaagagtca
aaggaagcacacgatcctcgggagaggagaaaatcaaccaacctggataatctcccgtgg
gactggcaaaccggcgctctggtccttgcggtttgcgcctgcatagtattctttctggtg
gcgggatgctcggctctcgtttacgcgaggcaatggcggcgtatgaagaggaatttcgag
ccagcgggcctcgaggagatctcggccaggttgaatctgatggtgaaggcagagttagcc
gaactggtcgcaggagcgccgatgaatccaggtgatcccgagaccagatgtcagtatctt
gagaagcttttagaccggaaacgagagactccggtggtggcggcggcggcggcagcggcg
gcggcggctagctggccggtggaggcgggcggcaacttgtacatcgaggaggggggcacg
ccgaggagtaaacgatcgcaaatcgcgcggattcagcgtaacatcgagaccattcttagt
cacaagacgaacggcgccgattga

DBGET integrated database retrieval system