KEGG   Desulfotomaculum reducens: Dred_2055
Entry
Dred_2055         CDS       T00494                                 

Definition
(GenBank) SSU ribosomal protein S16P
  KO
K02959  small subunit ribosomal protein S16
Organism
drm  Desulfotomaculum reducens
Pathway
drm03010  Ribosome
Brite
KEGG Orthology (KO) [BR:drm00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dred_2055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:drm03011]
    Dred_2055
   03029 Mitochondrial biogenesis [BR:drm03029]
    Dred_2055
Ribosome [BR:drm03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dred_2055
  Bacteria
    Dred_2055
Mitochondrial biogenesis [BR:drm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dred_2055
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: ABO50572
UniProt: A4J669
LinkDB
Position
complement(2250791..2251060)
AA seq 89 aa
MAVKIRLRRMGAKKNPFYRIVVADSRSPRDGRFIEEIGYYDPIKKPAEVKIDEAKAQDWL
KKGAQLSDTAKSLFVKAGIIPGRAKTNEA
NT seq 270 nt   +upstreamnt  +downstreamnt
atggctgttaaaattcgtctgagacgtatgggggctaagaaaaaccccttttaccgtata
gtggttgccgattcccgttctccacgtgacggccgtttcattgaggagattggttattat
gatcccatcaagaaacccgctgaagtaaaaattgacgaggcaaaggctcaagattggtta
aagaaaggcgcccagctttctgatactgccaagtcactgttcgtaaaagccggtattatc
ccaggtcgggccaagaccaatgaggcctaa

DBGET integrated database retrieval system