KEGG   Desmodus rotundus (common vampire bat): 112299134
Entry
112299134         CDS       T05907                                 

Gene name
ZBTB17
Definition
(RefSeq) LOW QUALITY PROTEIN: zinc finger and BTB domain-containing protein 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04110  Cell cycle
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112299134 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112299134 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    112299134 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112299134 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112299134 (ZBTB17)
   04121 Ubiquitin system [BR:dro04121]
    112299134 (ZBTB17)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    112299134 (ZBTB17)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     112299134 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2H2_6 zinc_ribbon_15 Zn-ribbon_8 zf-BED zf-C2HC_2 zf_UBZ zf-Di19 zf-C2HE Packaging_FI XPA_N DUF3268
Other DBs
NCBI-GeneID: 112299134
NCBI-ProteinID: XP_024410028
LinkDB
Position
Unknown
AA seq 837 aa
MAAMDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQK
DVVHLDISNAAGVETETQRGQVTGLAVSERVCGRALTKASADTLVGVSSGGLGQVLEFMY
TAKLSLSSENVDDVLAVASFLHMQDIITACHALKSLTEPAASPGDNTEALAMEGGDRRAK
DKKSAATALSELDPVGSSSSAGSGKEPKEERGGQAESAASGAEQTEKADVPREPPPVEPK
PDPTSGMAAAEAEAVLSESLEQEMQVEPARKGEEEQEEEDTVSAVVKEEGPQLDKGDGPE
ESEESASTDSGQELGVETRGLRLGTYGDRTESKAYGSVIHKCEDCGKEFTHTGNFKRHIR
IHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSG
EARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKEH
KCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCIH
CQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKR
FVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRV
DNLRSHVKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAA
VTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVM
FQTDADFYQQYGPGSTWPAGQVLQAGELVFRPRDGADGQPALAETPPTAPECPPPAE
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggcagccatggattttccccagcacagccagcacgtcttggagcagctgaaccagcag
cggcagctggggcttttgtgtgactgcacttttgtggtggacggtgtcgattttaaggcc
cataaagcagtgctggcggcctgcagcgagtacttcaagatgctcttcgtggaccagaag
gatgtggtgcacctggacatcagtaacgcggcaggtgtggaaactgagacccagagaggt
caggtgactggcctggcggtcagcgagagagtttgtggcagagccctgacgaaagccagt
gctgacacactcgttggagtgtcctctggtggcctggggcaggtgctggagtttatgtac
acggccaagctgagcctgagctctgagaacgtggacgatgtgctggccgtggccagcttc
ctgcacatgcaggacatcatcacggcctgccacgccctcaagtcactcactgagccggct
gccagccctggggacaatacggaggccttggccatggaaggaggggacaggagagccaaa
gacaagaagtctgctgccaccgcactgagtgagctggaccctgtgggaagcagttcatct
gcgggctcaggcaaggaacccaaagaggagcgcggtggtcaggctgagagtgcggccagt
ggtgcagagcagacagagaaggccgatgtcccccgggagccaccgccagtagagcccaag
cccgaccccaccagtggcatggctgctgctgaggccgaggctgtcttgtcagagagcttg
gagcaagaaatgcaggtggagccggccaggaaaggagaagaagagcaagaggaggaggac
accgtctctgctgtggtcaaggaggaggggccgcagctggacaagggagatggccctgag
gagagcgaggagtcagccagcacagactcgggccaggagctgggggtagagacccggggc
ctgcgcctgggcacctacggcgaccgaaccgagtccaaggcctatggctccgtcatccac
aaatgcgaggactgtgggaaagagttcacgcacacagggaacttcaagcggcacatccgc
atccacaccggcgagaagcccttctcatgccgggagtgcagcaaggccttctccgaccca
gccgcctgcaaggcccacgagaagacacacagcccactgaagccatatggctgcgaggag
tgtggcaagagctaccggctcatcagcctgctgaacctgcacaagaagcggcactcgggc
gaggcgcgctaccgctgcgaggactgcggcaagctcttcaccacgtccggcaacctcaag
cggcaccagctggtgcacagtggcgagaagccctaccagtgcgactactgtggccgatcc
ttctccgaccccacttccaagatgcgccacctggagactcacgacaccgacaaggagcac
aagtgccctcactgcgacaagaagttcaaccaggtggggaatctaaaggcccacctgaag
atccacatcgcggatgggcccctcaagtgccgagagtgtgggaagcagttcaccacctca
gggaacctgaagcggcaccttcggatccacagcggggagaagccctacgtgtgcatccac
tgccagcggcagtttgctgaccccggcgccctgcagcggcacgtccgcatccacacgggc
gagaagccgtgccagtgcgtgatgtgcggcaaagccttcacccaggccagctccctcatc
gcccacgtgcgccagcacactggggagaagccctacgtctgcgagcgctgcggcaagaga
ttcgtccagtccagccagttggccaatcacattcgccaccacgacaatatccgcccccac
aagtgcagcgtgtgcagcaaggcctttgtgaacgtgggagacctgtccaagcacatcatc
atccacactggagagaagccttacctgtgtgacaagtgcggtcgtggcttcaaccgggtg
gacaaccttcgttcccatgtgaagactgtgcaccagggcaaggcaggcatcaaaatcctg
gagccagaggagggtggtgaggtcagcgtagtcactgttgatgacatggtgacgctggcc
accgaggcactggcggcaacagccgtcactcagctcacagtggtaccagtgggggctgct
gtgactgccgacgagactgaagttcttaaagccgagatcagcaaagctgtgaagcaagtg
caggaagaagaccccaacacccatatcctctacgcctgcgactcttgtggggacaaattc
ttggatgccaacagcctggcccagcacgtgcggatccacacagcacaggcactggtcatg
ttccagacagatgcggacttctaccagcagtacggaccaggcagcacgtggccggccggg
caggtgttgcaggctggggaactggtcttccgccctcgggatggggctgatggccaacct
gctctggcagagacaccccccacagccccagaatgtccaccgcctgccgagtga

DBGET integrated database retrieval system