KEGG   Desmodus rotundus (common vampire bat): 112302171
Entry
112302171         CDS       T05907                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta
  KO
K08525  retinoid X receptor beta
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro03320  PPAR signaling pathway
dro04659  Th17 cell differentiation
dro04919  Thyroid hormone signaling pathway
dro04920  Adipocytokine signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05216  Thyroid cancer
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112302171 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112302171 (RXRB)
   03320 PPAR signaling pathway
    112302171 (RXRB)
   04919 Thyroid hormone signaling pathway
    112302171 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    112302171 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112302171 (RXRB)
   05202 Transcriptional misregulation in cancer
    112302171 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    112302171 (RXRB)
   05216 Thyroid cancer
    112302171 (RXRB)
   05222 Small cell lung cancer
    112302171 (RXRB)
   05223 Non-small cell lung cancer
    112302171 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112302171 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dro03310]
    112302171 (RXRB)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    112302171 (RXRB)
Nuclear receptors [BR:dro03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   112302171 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 112302171
NCBI-ProteinID: XP_024413534
LinkDB
Position
Unknown
AA seq 508 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWXXXXRDGMGGCGRDSRSPDSSSQN
PLSQGAPPHSPPGPPLPPSAAQSLGGSGAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPA
PPGFSGPVSSPQINSTVSLPGGGSGTPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICG
DRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATG
MKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSS
SSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSI
DVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKMRDMRMDKTELGCLRAII
LFNPDAKGLSSPSEVEALRERVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLE
HLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtcctgggctgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcnnnnnnnnnna
cgggacgggatgggcggctgcgggcgggactcccgaagcccagacagttcctcccaaaat
cccctttcccaaggtgctcctccccattctcctcctgggccacctctaccaccttcagcg
gcccagtcccttggaggctctggggctccacccccacccccaatgccaccacccccgctg
ggctcccccttcccagtcatcagctcttccatggggtcccctggtctgccccctccagct
cccccaggattttccgggcctgtcagcagtcctcagattaactcaacagtgtcgctccct
gggggtgggtctggcacccctgaagatgtgaagccaccagtcttaggggtccggggcctg
cactgtccaccccctccaggtggccctggagctggcaaacgactgtgtgcaatctgtggg
gaccgaagctcaggcaaacactatggggtttacagttgcgagggctgcaaaggcttcttc
aagcgtacgattcggaaggacctgacctactcgtgccgggacaacaaggactgcacagtg
gacaagcgccagcggaaccgttgtcagtactgccgctaccagaagtgcttggccactggc
atgaagagggaagcggtacaggaggagcggcagcgggggaaggacaaggacggggatggg
gagggggctgggggagcccctgaggagatgcctgtggacaggatcctggaggcagagctc
gctgtggagcagaagagtgaccagggcgttgagggtcctgggggaactgggggtagcagc
agcagcccaaacgaccctgtgactaacatctgtcaggcagctgacaaacagctgtttacg
cttgttgagtgggcgaagaggatcccacacttttcctccttacctctggatgaccaggtc
atattgctacgggcaggctggaacgagctcctcattgcctccttctcccatcgatctatc
gatgtccgggacggcatcctcctggccaccggtcttcacgtgcaccgcaactccgcccac
tctgcaggcgtgggcgccatctttgatcggtccctctccagggtgctgacagagctagtg
tccaaaatgcgtgacatgaggatggacaagacagagcttggctgcctgagggcaatcatt
ctgttcaatccagacgccaagggcctctccagccccagtgaggtggaggccctccgggag
agagtgtatgcatccttggagacctactgcaaacagaagtaccctgagcagcagggacgg
tttgccaagctgctgctgcgtcttcctgccctcaggtccatcggccttaagtgtctagag
catctgtttttcttcaagctcattggtgacacccccattgacaccttcctcatggagatg
ctcgaggcgccccaccagctggcctga

KEGG   Desmodus rotundus (common vampire bat): 112306469
Entry
112306469         CDS       T05907                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro03320  PPAR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04659  Th17 cell differentiation
dro04919  Thyroid hormone signaling pathway
dro04920  Adipocytokine signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro04932  Non-alcoholic fatty liver disease
dro04976  Bile secretion
dro05160  Hepatitis C
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05216  Thyroid cancer
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112306469 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112306469 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112306469 (RXRA)
   03320 PPAR signaling pathway
    112306469 (RXRA)
   04919 Thyroid hormone signaling pathway
    112306469 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    112306469 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    112306469 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112306469 (RXRA)
   05202 Transcriptional misregulation in cancer
    112306469 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    112306469 (RXRA)
   05216 Thyroid cancer
    112306469 (RXRA)
   05222 Small cell lung cancer
    112306469 (RXRA)
   05223 Non-small cell lung cancer
    112306469 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112306469 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112306469 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112306469 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dro03310]
    112306469 (RXRA)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    112306469 (RXRA)
Nuclear receptors [BR:dro03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   112306469 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 112306469
NCBI-ProteinID: XP_024418220
LinkDB
Position
Unknown
AA seq 439 aa
MAAPSLHPSLGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
ALGFGTGSPQLSSPMNPVSSTEDIKPPLGINGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNESEVESTSGASEDMPVEKILEAELAVEPKTETYVEANMGLNPNSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRSSAHSAGVGAIFDRVLTELVSKMRDMHMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgctccctcgctgcacccctccctggggcccggcatcggctcctcgctcggctcc
ccgggccagctgcactcacccatcagcaccctgagctcccccatcaacggcatgggcccg
cccttctcagtcatcagctcccccatgggtccccactccatgtctgtgcccaccacacct
gccctgggctttggcaccggcagcccccagctcagctcgcccatgaaccccgtcagcagc
accgaggacatcaagcccccactgggcatcaatggcgtcctcaaagtccccgcccacccc
tcagggaacatggcgtccttcaccaagcacatctgtgccatctgcggggaccgctcctca
ggcaagcactacggcgtgtacagctgcgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacctgccgggacaacaaggactgcctcatcgacaagcgccag
cgcaaccgctgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgcgaa
gctgtgcaggaggagcggcagcggggcaaggaccggaacgagagcgaggtggagtccaca
agtggcgccagcgaggacatgccggtggagaagatcctggaggccgagctggccgtggag
cccaagaccgagacgtacgtcgaggccaacatggggctgaaccccaactcgcccaatgac
cctgtcaccaacatctgccaagcggcagacaagcagctcttcacgctggtggagtgggcc
aagcgcatcccgcacttctcggagctgccgctggacgaccaggtcatcctgctgcgggcg
ggctggaacgagctgctcatcgcctccttctcccaccggtccatcgccgtgaaggatggg
atcctgctggccaccgggctgcacgtgcaccggagcagtgcccacagcgcgggcgtgggt
gccatcttcgacagggtcctgaccgagctcgtgtccaagatgcgggacatgcacatggac
aagacggagctgggctgcctgcgcgccatcgtcctcttcaacccggactccaagggactc
tcgaacccggccgaggtggaggccttgcgggagaaggtctacgcgtccctggaggcgtac
tgcaaacacaagtacccggagcagccggggaggttcgccaagctgctgctccgcctgccc
gccctgcgctccatcggtctcaagtgcctggagcatctcttcttcttcaagctcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaggccccacaccaaatgacttag

KEGG   Desmodus rotundus (common vampire bat): 112322188
Entry
112322188         CDS       T05907                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma
  KO
K08526  retinoid X receptor gamma
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro03320  PPAR signaling pathway
dro04659  Th17 cell differentiation
dro04919  Thyroid hormone signaling pathway
dro04920  Adipocytokine signaling pathway
dro04928  Parathyroid hormone synthesis, secretion and action
dro05200  Pathways in cancer
dro05202  Transcriptional misregulation in cancer
dro05216  Thyroid cancer
dro05222  Small cell lung cancer
dro05223  Non-small cell lung cancer
dro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112322188 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112322188 (RXRG)
   03320 PPAR signaling pathway
    112322188 (RXRG)
   04919 Thyroid hormone signaling pathway
    112322188 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    112322188 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112322188 (RXRG)
   05202 Transcriptional misregulation in cancer
    112322188 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    112322188 (RXRG)
   05216 Thyroid cancer
    112322188 (RXRG)
   05222 Small cell lung cancer
    112322188 (RXRG)
   05223 Non-small cell lung cancer
    112322188 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112322188 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dro03310]
    112322188 (RXRG)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    112322188 (RXRG)
Nuclear receptors [BR:dro03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   112322188 (RXRG)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 112322188
NCBI-ProteinID: XP_024435594
LinkDB
Position
Unknown
AA seq 550 aa
MARHYTYGKGHVFSLRNRKNLLRALCGRPDLEADSWLIREGWPSPRSRLRGGDDHSRSPE
LKGGSCAWGWAVGFRRRPERTRNGRGNMYGNYSHFMKFPTGFGGAPGHSGSTSMSPSAAL
PSGKPMESHPSYTDTPGSAPRTLGTVGTPLTALGSPYRVITSAMGPPSGALAAPPGVNLV
APPSSQLNVVNSGGLSEDIKPLPGLPGIGSMNHPSSSPGSLVKHICAICGDRSSGKHYGV
YSCEGCKGFFKRTIRKDLLYTCRDSKGCLIDKRQRNRCQYCRYQKCLLMGMKREAVQEER
QRGRERAESEAEGASGGHEDMPVERILEAELAVEPKTEAYGDVSTENSTNDPVTNICHAA
DKQLFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHV
HRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSDVEAL
REKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLM
EMLEAPLQVT
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggccaggcattacacgtacgggaaaggtcacgtcttcagtttacggaatcgcaagaac
ctgctacgcgcgctatgtggccgccccgatctagaggcggattcctggctcatccgggag
ggctggcccagcccgcgctcccggctgcggggcggcgatgaccactctcggtcgcccgag
ttgaagggcgggagctgtgcctggggctgggccgtgggcttcaggagacgcccggagagg
acgaggaacggacgaggaaacatgtacgggaattattcgcacttcatgaagttccccacc
ggcttcggcggtgcccctggccactctggctccacgtccatgagcccgtcggcagccctg
cccagcgggaagcccatggagagccaccctagctacacggacacccccgggagcgctccg
cggactctgggcacggtggggacccccctgaccgccctgggctccccgtatcgagtcatc
acgtcggccatgggcccaccctcaggagcgctggcggcccctccaggggtcaacctggtc
gccccacccagctctcagctcaatgtggtcaacagtggcggcctttccgaggacatcaag
cccttaccggggctccccgggatcggaagcatgaaccacccgtcctccagccccgggtct
ctggtgaagcacatctgtgccatctgcggggacaggtcctcaggcaagcactacggcgtg
tacagctgcgagggctgcaagggcttcttcaagcggaccatccgcaaggacctgctgtac
acctgccgggacagcaagggctgcctcatcgacaagcgccagcgcaaccgctgccagtac
tgccgctaccagaagtgcctgctcatgggcatgaagcgcgaagctgtgcaggaggagagg
cagaggggccgggagcgggcggagagcgaggccgagggggccagcgggggccacgaggac
atgcccgtggagcgcattctggaggccgagcttgctgtggaaccaaagacggaggcctac
ggcgatgttagcacggagaactcgacaaatgaccccgtgactaacatatgtcacgccgcc
gacaagcagctgttcaccctcgtcgagtgggccaagcgcatcccccacttctccgacctc
accttggaggaccaggtcatcctgctccgggcaggatggaacgagctcctgatcgcctcc
ttctcccaccgctcggtgtccgtgcaggacgggatcctgctggccacgggcctgcatgtg
caccggagcagcgctcacagcgcgggcgtgggctccatcttcgacagagtcctgaccgag
ctggtctccaaaatgaaagacatgcagatggacaagtcggagctgggctgcctgcgggcc
atcgtgctgtttaacccagatgccaagggtctgtccaacccctccgatgtggaggcgctc
cgggagaaggtctacgccaccctcgaggcctacaccaagcagaagtacccggagcagcca
ggcaggttcgccaagctgctgctgcggctgccagccctgcgctccatcggcttgaagtgc
ctggaacacctcttcttcttcaagctcatcggggacacgcccatcgacaccttcctcatg
gagatgctggaggctccgcttcaggtcacctga

DBGET integrated database retrieval system