Desmodus rotundus (common vampire bat): 112302798 Help Entry 112302798         CDS       T05907                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism dro  Desmodus rotundus (common vampire bat) Pathway dro04060   Cytokine-cytokine receptor interaction dro04151   PI3K-Akt signaling pathway dro04217   Necroptosis dro04620   Toll-like receptor signaling pathway dro04621   NOD-like receptor signaling pathway dro04622   RIG-I-like receptor signaling pathway dro04623   Cytosolic DNA-sensing pathway dro04630   JAK-STAT signaling pathway dro04650   Natural killer cell mediated cytotoxicity dro04936   Alcoholic liver disease dro05152   Tuberculosis dro05160   Hepatitis C dro05161   Hepatitis B dro05162   Measles dro05163   Human cytomegalovirus infection dro05164   Influenza A dro05165   Human papillomavirus infection dro05167   Kaposi sarcoma-associated herpesvirus infection dro05168   Herpes simplex virus 1 infection dro05169   Epstein-Barr virus infection dro05170   Human immunodeficiency virus 1 infection dro05171   Coronavirus disease - COVID-19 dro05200   Pathways in cancer dro05320   Autoimmune thyroid disease dro05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:dro00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112302798    04151 PI3K-Akt signaling pathway     112302798   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112302798  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112302798  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112302798    04621 NOD-like receptor signaling pathway     112302798    04622 RIG-I-like receptor signaling pathway     112302798    04623 Cytosolic DNA-sensing pathway     112302798    04650 Natural killer cell mediated cytotoxicity     112302798  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112302798   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112302798    05161 Hepatitis B     112302798    05160 Hepatitis C     112302798    05171 Coronavirus disease - COVID-19     112302798    05164 Influenza A     112302798    05162 Measles     112302798    05168 Herpes simplex virus 1 infection     112302798    05163 Human cytomegalovirus infection     112302798    05167 Kaposi sarcoma-associated herpesvirus infection     112302798    05169 Epstein-Barr virus infection     112302798    05165 Human papillomavirus infection     112302798   09171 Infectious disease: bacterial    05152 Tuberculosis     112302798   09163 Immune disease    05320 Autoimmune thyroid disease     112302798   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112302798   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112302798  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dro04052]     112302798 Cytokines and neuropeptides [BR:dro04052]  Cytokines   Interferons    112302798 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF4164 Motif Other DBs NCBI-GeneID:  112302798 NCBI-ProteinID:  XP_024414085 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALRFSFLVALVALSCNSICSLGCDLPQTHSLVNRRSLMLLGQMRRISPFFCLKDRKDFG FPQEVFSGNQFQKAQATSVIQEMVGQTFHLFSTEGAFAAWDKTLLDQLCNGLYQQLSDLE ACLTQEVGMEEAPLMSEDSILAVRKYFQRITVYLQEKQHSPCAWETVRAEIRRSLSLSAN LEEEGIA NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgcgcttttccttcctggtggccctggtggcactcagctgcaactccatctgc tctctgggctgtgacctgcctcagacccacagcctggtaaacaggaggagcttgatgctc ctgggacaaatgagaaggatctcccctttcttctgcctgaaggacagaaaggactttggg tttccccaggaggtgttcagtggcaaccagttccagaaggctcaagccacttctgtcatc caggagatggtcgggcagaccttccacctcttcagcacagagggcgcatttgctgcttgg gacaagaccctcctagaccaactctgcaatggactttatcagcagctgagtgacctggaa gcctgcctgacgcaggaggtggggatggaagaggctcccctgatgagtgaggactccatc ctggctgtgaggaagtacttccagagaatcactgtctacctgcaggagaagcagcacagc ccttgtgcctgggagactgtcagagccgaaatcaggagatccttgtctttatcagcaaac ttggaggaagaggggattgcgtag

DBGET integrated database retrieval system