KEGG   Desulfohalobium retbaense: Dret_2429Help
Entry
Dret_2429         CDS       T00989                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00564  Glycerophospholipid metabolism
drt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dret_2429
Enzymes [BR:drt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dret_2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_3 Lycopene_cycl HI0933_like Thi4 Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACV69711
UniProt: C8X5L4
LinkDB All DBs
Position
complement(2782787..2784346)
Genome map
AA seq 519 aa AA seqDB search
MDREALIEQLDAVATWDVLVIGGGATGLGVGLDAAARGYQAVVLEQGDFAQATSSRSTKL
IHGGVRYLQQGNVALVMEALHERGRLLHNAPHLVYNQAFVVPDYKWWERPFYGVGLKLYD
MLAGKLGFGRSRMLSRSQTLEYIPQLRQDGLRGGVIYHDGQFDDTRLAVTLAQTMVDQGG
CALNHVQVTEVCKDAEGVVQGVVCQDRISGREYRLNAKVVVNAAGIFVDEIRRMDVPDCT
PLIAPSQGVHLVLDNRFDPGETAIMVPHTDDGRIIFMVPWHGRVLVGTTETSLESVALEP
RPLPEEIEFLLSHASRYLDQPVHREDILSVFAGIRPLIAGEEAAKTSSLSRGHHLTVSHS
GLVTIGGGKWTTYRKMAEDTVDTAAQFAGLEERPCPTQHMRLHGWTAEADSNDFLSLYGT
DRAAIESLMRTDPDLADRIHPRLPYRKAEVVWGTRQESARTVADILAHRTRALLLDARAS
MEAAPEVARLMARELSRDEEWQAAEIARYCDKAAFFYPE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagaggccctgattgaacaattggatgcggtggccacctgggatgtgctcgtc
atcggcggcggcgccaccgggttgggcgtcggcctcgacgctgcggcccggggatatcag
gccgtcgttcttgaacaaggggatttcgcgcaggcaacctcgagccggagcaccaaactc
atccacggcggtgtgcgctatttacaacagggcaatgtggccctggtcatggaggccctg
catgagcggggcaggctgctgcataacgcaccacatctggtgtacaaccaggcctttgtc
gtccccgattacaaatggtgggagcgtccgttttacggggtcggcctcaaactctacgac
atgctggctggcaagctcgggtttggccgctccaggatgctcagccgcagccagaccctg
gagtatattccccaattgcgacaggacggtctgcggggcggggtcatctaccacgacggg
cagttcgatgatacccggctggctgtgaccttggctcagactatggtcgatcagggcggg
tgcgctctgaaccatgtgcaggtgacggaggtgtgcaaggatgctgaaggagtggtccag
ggcgttgtatgccaagaccgcatcagcggccgggagtaccggctcaacgccaaggtggtg
gtcaacgccgcagggatttttgtcgacgagatccggcgtatggatgtgccagactgtacc
ccgttgattgccccgagccagggcgtccatcttgtgctcgataaccggttcgatcccggg
gagacagcgatcatggtcccccatacagatgacggccggatcattttcatggttccttgg
catggccgcgtgcttgtcgggaccacggaaacgtcgctggagagtgtggccctcgaaccg
cgccccttgcctgaagaaatcgagtttctgctctcccatgccagccgctatctggaccag
ccggtgcaccgggaggatatcctttcggtgtttgctggcatccgtccccttatcgctggc
gaggaagcggccaaaacgtcttccctgtctcgaggccaccatctgaccgtttcccattcc
ggtctggtgaccatcggcggcggcaagtggacgacctaccgcaaaatggccgaggacact
gtggacaccgcggcccagttcgccggcctggaggaaaggccgtgccctacgcagcacatg
cggttgcacggctggaccgccgaagcggattccaacgattttttgtccctgtacggcacg
gacagggcggccatagaatcgctgatgcgcaccgatccggacctggcggatcggatccat
ccacgtctgccctatcgcaaagccgaagtggtctggggcacccggcaggaaagcgctcgt
acagtggccgatatccttgcccaccgcacccgcgccctgcttctggacgccagggcgagc
atggaagccgctcctgaagtcgcccggctcatggcccgagagttgagccgggacgaagag
tggcaggctgcggaaatcgcccggtactgcgacaaggcggcctttttttaccccgaataa

DBGET integrated database retrieval system