KEGG   Drosophila simulans: Dsimw501_GD18446
Entry
Dsimw501_GD18446  CDS       T01065                                 

Gene name
Dsim_GD18446
Definition
(RefSeq) uncharacterized protein
  KO
K00586  diphthine methyl ester synthase [EC:2.1.1.314]
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dsi03012]
    Dsimw501_GD18446 (Dsim_GD18446)
Enzymes [BR:dsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.314  diphthine methyl ester synthase
     Dsimw501_GD18446 (Dsim_GD18446)
Translation factors [BR:dsi03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    Dsimw501_GD18446 (Dsim_GD18446)
SSDB
Motif
Pfam: TP_methylase
Other DBs
NCBI-GeneID: 6729125
NCBI-ProteinID: XP_002104446
FlyBase: FBgn0189970
UniProt: B4R0M6
LinkDB
Position
3R
AA seq 281 aa
MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSILGCSLEDMQEFYGRPLLLADRDL
VEQGADEILAGAGESDVALLVVGDPFGATTHTDFILRAKEKNIPYKVIHNASIMNAVGCC
GLQLYKFGETVSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMRKRK
EYMPPRFMTVAEAAHQLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEM
RSTDLGGPLHSLIIPAKEMHPLEVEFLQQYAASIKLDDYNH
NT seq 846 nt   +upstreamnt  +downstreamnt
atgttttacctaatcggcctcggccttggcgacctgaaggacatcacggtcaagggtctg
gagatagtgaagcaatgcagtcgcgtctatctggagatgtacacctcgattctgggctgc
agccttgaggatatgcaagagttctacggacgaccgctgctgctggccgaccgcgatctg
gtggagcagggcgctgatgagatcctggccggtgcgggcgaatccgatgtggcgctgctc
gtggtgggcgacccctttggcgccaccacccacacagacttcatactgcgcgccaaggag
aagaacatcccctacaaggtcatccacaatgcatcgatcatgaacgccgtcggctgctgc
ggcctgcaattgtacaaattcggcgagaccgtttcgattccttactgggacgagacatgg
aagccggacagcttctacgacaagatcaagctgaatcgcctgcacaacatgcacacgctg
tgcctgctggacatcaaggtgaaggagcccacgccggagtccttgatgcgcaaacgcaag
gagtacatgccaccgcgtttcatgaccgtggcggaggcggcccatcagttgctgtccatt
gtggagaagaaggactcgctggagaagaacacagtgctcaacgagcagtcactgtgcgtt
gggctggcccgtgttggccaggagtcgcagcagattgccgttggcacgctgctcgagatg
cgctcgaccgatctgggcggaccgctgcactcgctcatcattcccgccaaggagatgcat
ccgctggaggtggagttcttgcagcagtatgccgccagcatcaagctggacgactacaac
cactaa

DBGET integrated database retrieval system