KEGG   Drosophila simulans: Dsimw501_GD21854
Entry
Dsimw501_GD21854  CDS       T01065                                 

Gene name
Dsim_GD21854
Definition
(RefSeq) uncharacterized protein
Organism
dsi  Drosophila simulans
SSDB
Motif
Pfam: Flu_B_M2
Other DBs
NCBI-GeneID: 6732633
NCBI-ProteinID: XP_002079750
FlyBase: FBgn0193273
UniProt: B4Q8C5
LinkDB
Position
2L
AA seq 146 aa
MPDKRPLDPLQPVLYIDHCRYRQTYRKRALLLHSSLAEALNAIQPRVKLQLRINDKGPPE
DGSFEVAIAPQPTDDSKARQSVWTGLRRMPSASKVPHVDDILTPVCFALKLRDPHKESHR
RMLTNLRHNEGSRGRTRTIKNVLNNT
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcccgacaaaaggccactggatccactccagccggtgctctacattgaccactgccgt
tatcgtcaaacttatcgcaagcgagccctgctcctccattcttcgctggcggaggcactg
aacgccattcagccaagggttaagctccagctaaggatcaacgacaaaggcccgcccgaa
gatggatcctttgaggttgctattgctccgcaaccaactgatgattccaaggcccgtcaa
agtgtatggactgggctgaggcggatgcccagtgcatcgaaggttccccatgtggacgac
attctcaccccggtttgtttcgccctcaaattgagggatccgcacaaggaatcacatcgg
cggatgctgaccaatttgcggcacaacgagggcagtcgaggaaggacgaggactatcaaa
aatgtgttaaataatacctag

DBGET integrated database retrieval system