KEGG   Drosophila yakuba: Dyak_GE14302
Entry
Dyak_GE14302      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dya  Drosophila yakuba
Pathway
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE14302
   04215 Apoptosis - multiple species
    Dyak_GE14302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dya01002]
    Dyak_GE14302
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Dyak_GE14302
Peptidases and inhibitors [BR:dya01002]
 Cysteine peptidases
  Family C14: caspase family
   Dyak_GE14302
SSDB
Motif
Pfam: Peptidase_C14 DUF4347
Other DBs
NCBI-GeneID: 6531851
NCBI-ProteinID: XP_002092638
FlyBase: FBpp0259312 FBgn0231917
UniProt: B4P9P2
LinkDB
Position
2R
AA seq 325 aa
MTDECVTRNYGVGILSSNGAANRGSIIMADNTDAKGCTPEAVVVGGATAASASPLPANKF
VARMPVDRYASEYNMNHKHRGLALIFNHEYFDIPSLKSRTGTNVDAQELKKAFENLGFAV
TVHKDCKLRDILKHVEKAAEQDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTA
TFCPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTSYKIPIHADFLFSYSTIP
GYFSWRNINNGSWYMQSLIRELNANGKKYDMLTLLTFVNQRVALDFESNVPATPMMDRQK
QIPCLTSMLTRILRFGEKPNGNKAG
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaccgacgagtgcgtaaccagaaactacggagttggaattctcagctcgaacggagca
gcaaatcggggcagcattataatggctgataataccgatgccaagggctgtacgccggag
gcggttgttgttggtggtgcaactgcagcgagcgcctcccctctgccggccaacaagttt
gtggcccgaatgcccgtagatcggtatgccagcgaatacaacatgaatcacaagcatcgc
ggactggcactaatcttcaaccacgaatacttcgacataccctcgctgaagagtcgcacc
ggaacgaatgtagatgcccaggaattgaagaaggcctttgaaaacctgggatttgcggtg
accgtgcacaaggactgcaagttgagggacatcctgaagcacgtggagaaggccgccgag
caggatcacacggacaacgactgccttgcggtggccatcctctcgcacggggagcacggc
tacctctacgccaaggatacacagtacaagctggacaacatctggcactacttcactgcc
accttctgcccctcgttggcgggcaagccgaagctgttcttcatccaagcctgccagggc
gatcgtttggacggagggattaccctggagaagggcgttaccgagacggatggggagtcc
tcgacgagctacaagatacccatacacgctgacttcctattctcctactcaaccatcccg
ggctacttctcctggcgcaacatcaacaacggctcctggtacatgcagtcactgatccgc
gagctaaatgccaatggcaagaagtacgacatgctcaccctgctcacattcgtaaaccag
cgcgtagccctagactttgagtcgaacgtgcccgccactccgatgatggatcgccagaag
cagataccgtgcctcacctccatgctgacgcgcatactgcgcttcggcgagaaaccgaac
ggcaataaggctggctaa

DBGET integrated database retrieval system