KEGG   Drosophila yakuba: Dyak_GE17180Help
Entry
Dyak_GE17180      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
dya  Drosophila yakuba
Brite
KEGG Orthology (KO) [BR:dya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dya01009]
    Dyak_GE17180
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dya03019]
    Dyak_GE17180
   04131 Membrane trafficking [BR:dya04131]
    Dyak_GE17180
   03036 Chromosome and associated proteins [BR:dya03036]
    Dyak_GE17180
Enzymes [BR:dya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dyak_GE17180
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dyak_GE17180
Messenger RNA biogenesis [BR:dya03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Dyak_GE17180
Membrane trafficking [BR:dya04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    Dyak_GE17180
Chromosome and associated proteins [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Dyak_GE17180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 6524812
NCBI-ProteinID: XP_002100654
FlyBase: FBpp0262190 FBgn0234659
UniProt: B4PWL6
LinkDB All DBs
Position
X
AA seq 1187 aa AA seqDB search
MSPPIVTRRSAQQAKIQTRAMASKSKTGTAGAAATAAGVISGGSASGGGGSSGSISSGFN
AADPRKTNKPNAALLEAKRRARNNMLKNQGSGAQECVTDIFQNAVNCKGLVRKPTALIYD
ESMSQHCCLWDKEHYECPERFTRVLERCRELNLAERCLELPSRSATKDEILRLHTEEHFE
RLKATAGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLIAGKAHNGMAII
RPPGHHAMKAEFNGYCFFNNVALAAQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRV
VYFSIHRFEHGSFWPHLHESDYHAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPV
ALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADARVAVVLEGGYCLDS
LAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCADL
QDRDKEQELHKVLRHWIGGPPPVDRYPTRDTAIPLPPEKLASNAARLQVLRTETKLSVPS
VRVCYAYDAQMLLHCNLNDTGHPEQPSRIEHIHKMHGEYALLPRMKLLSARAATTDEVCL
AHTRAHVNTVRRLLGREPEDLYGAAAIYNSVYLHPRTFDCATLAAGSVLQAVDSVLRGES
RSGICNVRPPGHHAEQDQPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHI
FESNPKVLYISLHRYEHGAFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAF
QQLIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGMLTHWLSALASGRIIVCLE
GGYNVNSISYAMTMCTKTLLGDPVPTPQLGAAALQKPPTVAYQSCVESLQQCLQVQRNHW
RSLEFVGRRLPSDPVVGENNNEDFLTASLRHLNISNDDASGAAGGPAGDQPDCGDERPSG
SKPKVKVKTLTDYLAENKEALEQNEMFAVYPLKTCPHLRLLRPEEAPQSLDSGAACSVCG
STGENWVCLSCRLVACGRYMNAHMEQHAVESQHPLAMSTADLSVWCYACSAYVDHPRLYA
YLNPLHVDKFQEPMAWTHGCARREDGCYALGPDGRDEDSEDGVAGSSYCLRLERNNXPLA
IRVLDALTDYLCALCPPLRHLIQFLAEHLWPLLERIYLNLLHYFLAH
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcccatagtcacgcgacggagcgcgcagcaggcgaagattcagacgcgggca
atggccagtaaatcgaagacgggcacggcaggggcggcggcgacggcggcgggagtgatc
agcggtggctctgccagcggcggcggcggcagcagcggcagtatcagcagcggatttaat
gccgccgatccgagaaagacgaacaaaccgaacgcagcgctcttggaggcaaaacgtcga
gcacggaacaacatgctcaagaatcagggttccggcgcgcaggagtgcgtcacggatata
ttccagaatgctgtcaattgcaagggtctggtgcggaaacccactgccctgatctacgat
gagtccatgagccagcactgctgcctgtgggacaaggagcactacgagtgtcccgagcgc
ttcacacgcgtcctggaacgctgccgcgaactcaatctggcggagcgctgcctggagttg
ccctcgagatcggccaccaaggatgagatactgcgcctgcacacggaggagcacttcgag
cggctgaaggcgaccgccgggattcgcgatgacgagcgcatggaggagctgagctcccgc
tacgattcaatttacattcatccgtccaccttcgagctttccttgctggccagcggctcc
accatcgagctggtggaccatctgatcgccggaaaggcgcacaatggcatggccatcatc
cggccaccgggtcaccatgccatgaaggccgagtttaacggctattgcttcttcaacaac
gtggcactggccgcccagcacgccctcgacgtccacaagctgcagcgcatcctgatcatc
gactacgatgtgcatcatggacagggcacccagcggttcttctacaacgatcccagggtg
gtttacttctccatccatcgcttcgagcacggcagcttctggccgcatctgcacgagtcg
gactaccatgcgattggatcgggagcgggcacgggttacaactttaatgtgccgctgaac
gcgacggggatgaccaatggcgattacctggccattttccagcagcttctgctgcctgtg
gcgctggagttccagccggagctgatcatcgtgtcggctggctatgatgcggcgctgggc
tgtccggagggcgagatggaggtgacaccggcctgctatccgcacttgctgaatccgctg
ctgcgactggccgatgcccgggtggccgtcgttctggagggcggctactgcctggactcg
ctggccgagggtgcagcgctgaccctgcgctccctactcggtgatccctgcccgccgctg
gtggagacagtgcctctgccgcgtgcggaactcgcccaggccctgctcagctgcattgcc
gtgcaccgaccccactggcggtgtctgcagctccagcagacctacgattgcgccgatttg
caggaccgggataaggagcaggaactgcacaaggtgctgcgccattggattggcgggcca
ccgccggtggatcgttacccaacgcgcgatacggccattccgctgccaccggaaaagctg
gccagcaatgctgctcgtctgcaggtgctgcgcacggagacgaagctatcggtgccgtcg
gtgagggtgtgctatgcctacgatgcccagatgctgctgcactgcaatctcaacgatacg
gggcatccggagcagccgtcgcgtatcgagcacatccacaagatgcatggagagtacgct
ctgctgccgcgcatgaagctactgtccgccagagcggccaccacggacgaggtgtgcctg
gcccacacacgtgcccatgtgaatacagtgcgtcgattgctaggccgtgagccggaggat
ctgtatggcgctgccgcgatctacaactcggtgtacctgcatccgcgcaccttcgattgc
gccaccttggccgccggatccgtgctgcaggcggtggacagtgtgctgcgtggcgagtcc
cgcagcggcatctgcaacgtccgtccgccaggtcatcatgccgagcaggatcagccgcac
ggtttctgcatcttcaacaatgtggccattgcggcgcagtatgccattcgggatttcggt
ctggagcgcgtgctgatcgtggactgggacgttcatcacggcaatgggacgcagcacatc
ttcgagtccaatcccaaggtgctctacatcagcttgcatcgctacgagcacggcgccttc
ttccccaagggacccgatggcaacttcgatgtggtgggcaagggtgccggcaggggcttc
aatgtgaacataccctggaacaagaagggcatgggtgacctggagtacgcactggccttc
cagcagctgatcatgcccattgcgtacgagtttaatccccagctggtgttggtatccgcc
ggatttgatgctgccatcggtgatcccttgggcggatgcaaggtgacgcccgagggttac
ggcatgctcacccactggctgtcggctttggccagcggtcggataatcgtctgcctggag
ggtggctacaatgtgaactccatttcgtacgcgatgacgatgtgcaccaagacgctgctg
ggcgatcccgtgccgacgccccagctgggagccgctgcgctgcagaagccaccaacggtg
gcctaccagagctgcgtggaatctttgcagcagtgcctgcaggtgcaacgcaatcactgg
cgctcgctggagttcgtcggacggcggctgcctagcgatcctgtcgtgggcgagaacaac
aacgaggattttcttaccgcctccttgcgacacttgaatatctcaaatgacgatgcttcg
ggagcggcgggcggaccagccggcgatcagcccgactgcggcgatgagcgtcccagtggg
agcaagcccaaagtcaaggtaaaaacgctcaccgattacttggcggagaacaaggaggcc
ctcgagcagaatgagatgttcgccgtttatccgctcaagacgtgtccgcacttgaggctc
ctgcgtccggaggaggcgccccaatcactagacagcggagcggcgtgcagcgtttgcgga
tcgacgggggagaattgggtgtgcctgagctgccggctggtggcctgcggtcgctacatg
aacgcccacatggagcagcacgcggtggagtcgcagcatccgctggcgatgagcacggcc
gacctgtccgtgtggtgctacgcatgctctgcgtacgtggaccatccccgcctgtatgcc
tacctcaatccgctgcacgtggacaagttccaggagccgatggcctggacacatggctgt
gcgcggcgcgaggatggctgctatgcgctgggccccgatgggcgagatgaggactcggag
gatggcgtcgccggtagcagctactgcctgcgactggagcggaacaactgacccttggcc
atccgcgtgctggacgccctaacggactacttgtgcgcgctctgtccgccactcagacac
ctgatccagttcctggccgagcacctctggccgctgctggagcgcatttatcttaaccta
ttgcactacttcctggcccactga

DBGET integrated database retrieval system