Ewingella americana: GXP68_17980 Help Entry GXP68_17980       CDS       T06747                                  Symbol rhaM Name (GenBank) L-rhamnose mutarotase   KO K03534   L-rhamnose mutarotase [EC:5.1.3.32] Organism eame  Ewingella americana Brite KEGG Orthology (KO) [BR:eame00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     GXP68_17980 (rhaM) Enzymes [BR:eame01000]  5. Isomerases   5.1  Racemases and epimerases    5.1.3  Acting on carbohydrates and derivatives     5.1.3.32  L-rhamnose mutarotase      GXP68_17980 (rhaM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  rhaM Motif Other DBs NCBI-ProteinID:  QMV53015 LinkDB All DBs Position 3933728..3934042 Genome browser AA seq 104 aa AA seqDB search MIRKAFVMQVNPDAHAEYQRRHSPIWRELEETLKAHGAHHYSIFLDEQRSLLFATVEIES EARWNAVADTEICHKWWRHMADIMPTNVDSSPVSQELKAVFYLD NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgattcgtaaagcctttgtgatgcaggtaaatcctgatgcgcacgccgaatatcagcgg cggcactctcccatctggcgggagttagaagaaacattgaaagcccacggggcgcatcac tacagcattttcttggatgagcaacgcagcttgctgtttgccaccgtagaaattgaatct gaagcgcgctggaatgcagtagcagacactgagatttgccacaaatggtggcgacatatg gcggacatcatgcccaccaatgtggacagcagcccagtcagtcaggagctaaaagccgtt ttttacctcgactaa

DBGET integrated database retrieval system