KEGG   Erwinia amylovora ATCC 49946: EAM_0318Help
Entry
EAM_0318          CDS       T01199                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eay00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EAM_0318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eay02000]
    EAM_0318
Enzymes [BR:eay01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EAM_0318
Transporters [BR:eay02000]
 Other Transporters
  Pores ion channels [TC:1]
   EAM_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_2 GST_N_4 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: CBJ44993
LinkDB All DBs
Position
377564..378229
Genome map
AA seq 221 aa AA seqDB search
MMITVHHLNNSRSQRVLWLLEELEVPYQIKCYQREASMLAPDELKKVHPLGKSPVITDGN
RVVAESGAILEYLAAHYDAEDRLKLFDDEEVIQSRYWLHYAEGSLMPLLVMKLIFSRMGK
APVPWLLRPIGSAFGKGVQKGYIDPQLATHRQFIEQHLTSNEWFAGSRFSIADVQMSFPI
QAMTARGGAAGSPAIQAWLEKVQCRAAWQRALDKGGEIHLV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcactgtgcaccatcttaacaattcacgttcgcagcgagtgctgtggctgctg
gaagagctggaagtgccgtatcagattaaatgctatcagcgtgaggccagcatgctggct
cctgacgagctaaaaaaagtgcacccgctgggcaaatccccggttattaccgatgggaat
cgcgtggtggcggaatccggcgcgatcctggagtacctggcggcgcattatgacgccgaa
gatcggctgaaactttttgatgatgaagaggtaatacaatcgcgttattggttgcactat
gccgaaggttcattaatgccgttgctggtgatgaaactgatcttcagccggatgggtaaa
gcgccggtaccctggctgctgcgaccgattggtagtgcatttggtaaaggggtgcagaag
ggctatatcgatccccagttggccacccatcgccagtttatcgagcagcatctgaccagc
aatgagtggtttgccggcagtcgattcagcattgccgatgtgcagatgagctttccgata
caggcgatgaccgcgcgcggtggtgccgctggcagccctgcgattcaggcctggctggaa
aaagtgcagtgccgcgcggcctggcagcgcgctttggataaagggggcgaaattcacctt
gtgtga

DBGET integrated database retrieval system