Aromatoleum aromaticum: ebA1054 Help Entry ebA1054           CDS       T00222                                  Name (GenBank) Glutaredoxin protein   KO K03676   glutaredoxin 3 Organism eba  Aromatoleum aromaticum Brite KEGG Orthology (KO) [BR:eba00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:eba03110]     ebA1054 Chaperones and folding catalysts [BR:eba03110]  Protein folding catalysts   Protein disulfide isomerase    ebA1054 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  CAI06679 UniProt:  Q5P7N2 LinkDB All DBs Position 618917..619177 Genome browser AA seq 86 aa AA seqDB search MAKIRMYATNVCPYCVRAEQLLKRKGVTDIEKIRVDQDPSLRDEMIRLTGRRTVPQIFIG DLHVGGCDDLFDLDHAGKLDSLLAAP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatcagaatgtatgccacgaacgtgtgcccctactgtgtgcgtgccgaacag ctcctcaagcgcaaaggcgtgaccgacatcgagaagatccgcgtcgatcaggacccgtcg ttgcgcgacgagatgatcaggctcaccgggcgccggacggtaccgcaaatcttcatcggc gacctgcatgtcggcggttgcgacgatctgttcgatcttgaccacgccggcaaactcgat tccttgttggccgcgccctga

DBGET integrated database retrieval system