KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_29075Help
Entry
C2U52_29075       CDS       T05417                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U52_29075
Enzymes [BR:ebc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C2U52_29075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like Thi4 FAD_oxidored K_oxygenase NAD_binding_8 FAD_binding_3 DAO Glutaredoxin FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AUV10012
UniProt: A0A2I8QUY3
LinkDB All DBs
Position
complement(5504978..5506543)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSARSAEIKELLAEIAELSDKVSFKEDNTLAV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLTCHNCPDVVQALNLMAVLNPRIKHTAIDGGTYQNEITDRNVMGVPAVFVNGKE
FGQGRMTLAEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYDVDVIDSQSATKLTPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLGNVDIILNAQTTEVKGD
GSKLTGLEYRDRVSGDVHHIALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKRA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaacatgaaaacgcagctcaaggcttaccttgagaaactgactaaacct
gttgagctgattgccacgctggatgacagcgccagatcggcagagatcaaggaactgttg
gctgaaattgctgaactgtcagataaagtttcttttaaagaagacaacacgctggcagtg
cgcaaaccgtcgttccttattaccaacccaggttcaaaccaggggccgcgctttgcaggc
tcgccgctgggtcacgaatttacctcactggttctggcactgttgtggaccggtggtcac
ccgtcgaaagaagcgcagtctctgctcgaacagattcgcgatatcgacggtgattttgaa
tttgaaacctattactcactgacctgccataactgcccggatgtcgtacaggcgcttaac
ctgatggcagtgctgaacccgcgcattaaacatacggcgattgatgggggcacctaccag
aatgaaatcactgaccgtaatgtgatgggcgttccggctgtcttcgtcaatggtaaagag
tttggtcaggggcgtatgacgcttgctgaaatcgtggccaaaattgataccggcgcggaa
aaacgtgccgcagaagagctgaacaagcgtgacgcgtatgatgtgctgattgtcggttcc
ggcccgtctggtgcggcggcagcagtttactccgcacgtaagggtatccgtaccgggctg
atgggtgagcgttttggtggtcaggtgctggacaccgtggacatcgaaaactacatctcc
gtgccgaagaccgaaggtcaaaaactggcgggtgcgctgaaagcccacgtgtcggaatac
gacgttgatgtgattgattcgcaaagtgcgaccaaactgaccccggctgccgtggaaggt
ggtttgcatcagattgaaaccgcatccggtgccgtactgaaagcacgcagtatcatcatt
gcgactggggcaaaatggcgcaacatgaacgtgccgggcgaagaacagtatcgtactaaa
ggtgtgacctactgcccgcactgcgatggtccgctgtttaaaggtaaacgtgttgcggtc
atcggcggcggtaactcaggtgtggaagccgctatcgatctggcgggcattgtagaacat
gtcaccctgctggagtttgcgcccgaaatgaaagctgaccaggtgctgcaggataaagtg
cgtagcctcggtaatgtcgacatcatcttgaatgcgcaaactaccgaagtgaaaggcgat
ggcagcaaactgacggggctggagtaccgcgatcgcgtgagcggcgatgtgcatcatatc
gcgctggccggtatcttcgtgcagattggtttactgccgaatactacctggctggaaggt
gccattgagcgcaaccgtatgggcgaaattatcattgatgcgaaatgtgaaaccagcgtc
aaaggtgtgttcgcggcgggtgactgcaccacggtgccgtacaagcaaattattatcgcc
actggcgaaggtgcgaaagcctctctgagcgcattcgactacctgatccgcactaagcgt
gcataa

DBGET integrated database retrieval system