KEGG   Escherichia coli BL21(DE3): ECD_00330Help
Entry
ECD_00330         CDS       T00931                                 

Gene name
phoA
Definition
(GenBank) bacterial alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ebl  Escherichia coli BL21(DE3)
Pathway
ebl00730  Thiamine metabolism
ebl00790  Folate biosynthesis
ebl01100  Metabolic pathways
ebl02020  Two-component system
Module
ebl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ebl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ECD_00330 (phoA)
   00790 Folate biosynthesis
    ECD_00330 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECD_00330 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ebl04147]
    ECD_00330 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ebl00537]
    ECD_00330 (phoA)
Enzymes [BR:ebl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ECD_00330 (phoA)
Exosome [BR:ebl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECD_00330 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ebl00537]
 Enzymes
  ECD_00330 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ACT42229
UniProt: A0A140NEZ4
LinkDB All DBs
Structure
PDB: 

Position
366372..367787
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARAPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGRGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNAVTEANQQKPLLGLFADGNMPVRWQGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccgggcaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcacatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgcgctagaaaaaggcgggagaggatcgattaccgaacagctgcttaacgct
cgtgccgatgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatgctgcctcactgaatgcggtgacggaagcgaaccagcaaaaacccctgctaggactg
tttgctgacggcaatatgccagtgcgctggcaaggaccgaaagcaacgtaccacggcaat
atcgacaagcccgcagttacctgtacgcctaatccgcaacgtaatgacagcgtaccgacc
ctggcgcagatgactgataaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcatcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgacgaagccgtacaacgggcgctggaattcgctaaaaag
gatggcaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcg
ccggacaccaaagcgccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggtagtcagctgcgt
attgcggcgtatggcccacatgccgccaatgtcgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system