KEGG   Pectobacterium atrosepticum SCRI1043: ECA0092Help
Entry
ECA0092           CDS       T00186                                 

Gene name
sodA
Definition
(GenBank) manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Brite
Enzymes [BR:eca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECA0092 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAG73012
GeneDB: ECA0092
UniProt: Q6DB10
LinkDB All DBs
Position
complement(109636..110262)
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHSKHHQAYVNNANAVLESLPELAKLSVEELIAQ
LDKVPAEKKAALRNNAGGHANHSLFWKGLKLDTTLTGDLKAAIERDFGSVDAFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGTSGYPIVGLDVWEHAYYLKFQ
NRRPDYAKAFWNVLNWDEASARFASAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcgctgccttatgcttatgacgcactggaaccgcatttcgac
aaagaaacgatggaaattcaccattccaaacaccatcaggcttacgtcaataatgctaat
gccgtgctggaatctctgcctgaactggctaaattgtctgttgaagagctgattgctcaa
ctggataaagtccctgctgagaaaaaagcagcgctgcgtaacaacgctggcggccacgct
aaccacagcctgttctggaaaggcctgaaattagatactacgctgactggcgatctgaaa
gcagcaatcgaacgcgatttcggcagcgttgatgcgtttaaagaaaaatttgagcaagca
gcagcaacccgtttcggttctggctgggcttggctggttctgaaagacgacggcaaactg
gctgtagtctctactgcaaaccaagacagcccgctgatgggtgaagcaatttctggtacc
tctggctacccaatcgtcggtctggacgtatgggagcacgcttactacctgaaattccaa
aaccgtcgcccagattatgctaaagcattctggaacgtgctgaactgggacgaagcctca
gctcgcttcgctagcgcgaaaaaataa

DBGET integrated database retrieval system