KEGG   Pectobacterium atrosepticum SCRI1043: ECA1161
Entry
ECA1161           CDS       T00186                                 

Gene name
amtB
Definition
(GenBank) probable ammonium transporter
  KO
K03320  ammonium transporter, Amt family
Organism
eca  Pectobacterium atrosepticum SCRI1043
Brite
KEGG Orthology (KO) [BR:eca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eca02000]
    ECA1161 (amtB)
Transporters [BR:eca02000]
 Other transporters
  Pores ion channels [TC:1]
   ECA1161 (amtB)
SSDB
Motif
Pfam: Ammonium_transp DUF2919
Other DBs
NCBI-ProteinID: CAG74071
GeneDB: ECA1161
UniProt: Q6D814
LinkDB
Position
1316909..1318201
AA seq 430 aa
MKMKKLLSSLGLGVAALLPSWAMAATPTIDKADNAFIMICTVLVLFMTIPGIALFYGGLI
RSKNVLSMMTQVSVTFAMVCILWVVYGYSLAFSEGNAFFGGFSTFMLKGIGIESISGTYY
QFVHVAYQASFACITVALIVGAIAERIRFSAVLIFVGLWLTFSYLPMTHMVWGGGYLAMD
GALDFAGGTVVHINAAVAGLVGAYLLGKRAGFGKEAFKPHNLPMVFIGTAILYIGWFGFN
AGSAGAANGVAALAFLNTVVATAAAILAWVGGEWLVRGKPSLLGACSGCIAGLVAITPAA
GTVGVGGALIIGLAGGVAGLWGVTVLKRWLRVDDPCDVFGVHGVCGIVGCILTGVFTSAS
LGGTGYAEGVTMAHQVWVQLFSVIVCLVWSGVVAFVAFKVADMIVGLRVPEEQEREGLDV
NSHGESAYNQ
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgaaaatgaaaaaactactctcttcattaggtctcggtgtggcggcattactcccgtcc
tgggcaatggctgcgacaccgacaattgataaagcggataacgcttttattatgatttgt
accgtgttggtactttttatgactataccaggcatcgcactgttttatggcggcctgatc
cgttcgaagaacgtactgtccatgatgacgcaggtgagtgtaacgttcgcgatggtctgt
atcttgtgggtggtttacggatatagcctggccttcagtgaaggtaacgccttcttcggt
ggtttcagtacgtttatgctgaaaggcatcgggattgagtccatcagcggtacctactat
cagtttgtgcatgtggcttatcaggcttccttcgcctgtatcaccgttgcgttgattgtc
ggggcgatcgctgagcgtattcgtttctctgcggtgctgatttttgttgggctgtggctg
acgttctcctacctgccgatgacgcacatggtatggggcggtggctatctggctatggat
ggcgcgttagactttgctggcggtacggtcgttcacatcaacgccgcggttgctgggttg
gttggtgcttacctgctgggcaaacgtgctggctttggtaaagaagccttcaaaccgcat
aacctgccgatggtgtttattggtacggcgattctgtatatcggctggtttggtttcaat
gcggggtctgcgggtgctgctaacggtgtcgccgctctggctttcctgaacactgttgtt
gcgactgctgctgcgattctggcatgggttggtggtgagtggttggtacgcggtaaacct
tctctgctgggcgcgtgctctggctgtatcgcaggtctggtggcaattaccccagcagcg
ggtacggttggcgtgggtggcgccttgatcatcggtctggctggtggtgttgcgggcctg
tggggcgtaacagtactgaaaagatggctgcgtgtggatgacccgtgtgatgtgttcggt
gttcacggcgtgtgcggtatcgttggttgtatcttgacgggggtattcacgtcggcatcg
ctgggtggaacaggctatgctgaaggtgtgacaatggcgcaccaggtttgggtacagctg
ttcagcgtgattgtttgtctggtgtggtctggcgtggtggcatttgtcgccttcaaggtt
gcggatatgatcgttggtctgcgtgtacctgaagagcaagagcgcgaaggtctggacgtt
aacagccatggcgagagcgcttacaaccaataa

DBGET integrated database retrieval system