KEGG   Pectobacterium atrosepticum SCRI1043: ECA3384
Entry
ECA3384           CDS       T00186                                 

Definition
(GenBank) hypothetical protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: Ntox50
Other DBs
NCBI-ProteinID: CAG76284
GeneDB: ECA3384
UniProt: Q6D1R1
LinkDB
Position
complement(3800170..3800646)
AA seq 158 aa
MMRRGGQHLSPDPIGLGGGIQPQSYVHNPLEWVDPLGLTESGCKQPNSPENSQKPEVKKP
NISTKIHDGAQGKHIEGHNNYVEGKSVIDAKPQELLDNYHAGNVNTSRVINENKIKVDFG
DVNGTHKDMNGTNTSTSWGLIHSRKNGAHIVPALPDTI
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatgcggagaggggggcagcatctgtctccggatccgatagggctgggtgggggtatc
caaccacaaagttacgtacataatccgttagaatgggttgatccgctagggttgacggaa
tctggctgtaagcagccgaactcacctgaaaacagccaaaagccagaagttaaaaaacca
aatatttcaacaaaaattcatgacggcgcacaaggtaaacatatagaaggacataataac
tacgttgagggtaagagtgttatagatgctaagcctcaagaattattagataactaccat
gcaggaaatgttaatacctctagggtaattaacgaaaataaaattaaagtggattttggt
gatgtgaacggtactcataaagatatgaatggtactaatacttccacatcatgggggcta
atccatagccgtaaaaatggtgctcatattgttccggcgttgcctgatacaatttag

DBGET integrated database retrieval system