KEGG   Pectobacterium atrosepticum SCRI1043: ECA3421
Entry
ECA3421           CDS       T00186                                 

Definition
(GenBank) Rhs protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: RHS_repeat RHS DUF4595 CarboxypepD_reg DUF4112 SpaA
Other DBs
NCBI-ProteinID: CAG76321
GeneDB: ECA3421
UniProt: Q6D1M4
LinkDB
Position
complement(3829218..3834074)
AA seq 1618 aa
MSQDKQDSLHQSSAAAEKRFSTDKIIQGGCKECECETFVQYVYSSGDPVPNAPFVLTDSK
GNKTDGQTDGSGYFKVQDMACSTYQLDIKEGSDDFDSPDTVENNPVLQANPAHAALAGEY
FTLYLLLHEKGIVEYDTEDSERYDEVNVDDSTLSGRFFSNVEDKYQLAYDRFQTLKKQIN
AGDREFKRAINKIHHSLSAEVADQTTETAVLLLCQIILGFIPVVGQAPDVYFIGEWCWAA
YKKPDNLEDNYFLAEGALNVVGVIPGPGHALKIAGKSVVRAMKALEKSALDNQAVQLAVR
EIRNLSNGNIVRWLMDFAEKINKEAKEAINLLNKIITAIELMVNNAASSAKSWIVAFAKD
SFSAICGVIKKLIDKFKEIVDEIILKVNAFIGKIITRKSGEAIGKGKAIKPEIKVADKTP
SDVDGTPGHSSSTANTADGNTCSTSNQCKSEGEPVDMATGYMVEWRTDFQLASILPLVMK
RYYRSGGDRKPSLLGALWRSNWDMSLTLEDGVVTLTDGEFNQAIFVLPIEGESTRSPSNP
QWRLTRQQGRLILQDAGSLRYRFEHARGMELCLTSIEDRQDNQISLIWEFGILRWVALPD
NRLIHVETHRQRITCLTLCDTHRKPLKTLASYTYDSLGHLLSVRADEGRNFDYRYSPEGW
LLRWSDLALTWVEHDYDKKGRVIRDRTSEGYWPGRFEYDDDTLTSHYYSGFGGVISYVRD
ERNNILLKRTPDGGETLFEWVDNQLVAETDPLGGRTAYQRNDWGQVTEVALPDGATHQYA
YDENGQLLAYTDPLCSEWHYQRNAAGQVVEVNDPEGREWLYSYGETGQLATVIGPDGVLQ
RYHYNRRGLLSSLERDNALPVMFRYDDLDRLTERHIGHEAGVQVRRWEYDCVRESPSKVV
YEDGSETQFGYDVEGNLTAVTDALGQRYQFRYGAFDNLLEATDPLGATVRYHYNAEAEFA
GVTNSQGRDWTYGFDHSGRLSEERHYDGRVYRYRYDVADRLVQRTAPDGSALHYEHDTAG
RITRITARRADGETDGITELEYDVAGRLTQAASPDAVVEYVYNRAGQVTSETVNGEAVQS
GYDAGGQRAIVDGILAPLQLAWQSGRLSSLGIGSHQPLQFSHTAAGEEQRRSNGSGFALR
HEWSPTGLLQRQALEGADGRVNDVLERRYQYDVLDRLTGITDSHWGEQAFRLNGAGQMTA
ERRDEGRRRQARLFGYDSEQNLCEVSQIAPGLDETLKVQDAVVQSSARYDAAGRVIERGH
TQYRYDDCGRLAMKRETRPGFRPKETYFDWDVQDRLVRVSLPDGARWRYRYDAFGRRINK
VREGQVPSAQAVARVAYRWDGDQLIGQHQYRADGSAAREVQWVYEPGSFRPLAQLEAQGD
STQLHYIVTDLTGTARELCSEEGEIRWRGEQGLWGAHREERRPIPLRRYLGDAANEEVYC
ELRYQGQLYDAETGLYYNRHRYYDAESGQYLSPDPIGLAGGKRAYGYVKNPLSWVDPLGL
TPKEGKNGSDKGPDKKNSRAKINNIEDIFDNPDVLKGHTPESLKEELGGIPEGWKAGTMN
KSRTEDGFTLRELNERGNDVTDRYIQYHPGSRRHYDGAPYWKVSSGKNGTVRFPAEID
NT seq 4857 nt   +upstreamnt  +downstreamnt
atgagtcaggataaacaggattcattacaccaaagtagtgctgctgcggaaaaaaggttt
tcaacggataaaatcattcaaggggggtgtaaagaatgtgagtgtgaaacctttgttcaa
tatgtctattcgtcaggggatcctgtaccaaatgctccttttgttttaaccgatagcaaa
gggaataaaacggatgggcaaacggatggaagtgggtactttaaagtccaagatatggca
tgcagtacttatcaacttgatattaaagaaggttcagatgattttgattcccctgatacc
gtagaaaataatccggtacttcaagctaatcccgctcatgctgcattagcaggagagtat
tttaccctttatttactgctgcatgaaaaagggattgtagagtacgacactgaagacagt
gaacgttatgatgaagtaaatgttgatgatagtacattgagtggacgatttttttctaat
gttgaagataaatatcagctagcctatgaccgctttcaaacattaaaaaaacagattaat
gcaggggatcgtgaattcaagcgagcaattaataagattcatcatagtttgtcggcagag
gttgccgatcagacaacagaaacagcggttttgttgctttgtcaaattattctcggtttt
atccctgttgttggtcaagcacccgatgtttattttattggtgagtggtgctgggccgcc
tataagaaaccagataacttggaagataactactttcttgctgaaggtgcactgaatgtc
gtaggtgttattcctggtccaggacatgcgctaaaaattgcagggaaatctgttgtccgt
gcaatgaaagcattagaaaaaagtgcgttggataatcaagctgttcaactggctgttcgt
gaaattagaaatttgtctaatggtaatattgttcgatggttaatggacttcgcagaaaaa
attaataaagaggctaaagaagctataaatctgctcaataaaataattactgctattgaa
ttaatggtaaataatgccgcaagttcagcaaaaagttggattgttgcatttgcaaaagat
agtttttctgcgatttgtggtgttattaaaaaactcattgataaatttaaagaaattgtt
gatgagattatcctgaaggttaatgcatttattgggaaaataattaccagaaaatcagga
gaagcgataggtaagggaaaagctataaaacctgaaattaaggtagcggataaaacacca
tcagacgttgatgggactcccggccattcatcatctaccgctaacacagctgatggaaat
acctgctctacatcaaatcaatgcaaaagtgaaggtgaaccggtcgatatggccacgggt
tatatggtggagtggcgtactgatttccaactggcaagtattttaccgttggtgatgaaa
cgctattaccgatctggtggtgataggaagcctagtttattaggcgcactatggcgtagt
aactgggatatgagccttacacttgaagacggtgtggtgacgctgactgacggcgagttc
aatcaggcgatctttgttttgcctattgagggggaatccactcgttcgccatctaacccg
caatggcgtctgacccgccaacagggacggttgattttgcaagatgccggtagcttgcgc
tatcggtttgagcacgccagagggatggaattatgcttaacatcaatagaggatcggcag
gataaccagatctcgctgatttgggagtttggcatattacgctgggtggctttgcctgat
aatcgcttgattcatgtggaaactcatcgtcaacgtattacttgtttaacgttatgcgat
actcatcgcaagcctttgaaaacactggctagctatacctatgacagtctcgggcattta
ctgagcgtgcgagcggatgaggggcgtaactttgattatcgttattctcctgaaggttgg
ctgctgcgctggtcggatttagcgttgacctgggttgaacacgactacgataaaaaaggt
cgtgtaattcgtgatagaacctcggaaggttactggccggggcgctttgaatatgatgat
gatactctgaccagccattattatagcgggtttggtggagtgatcagctatgtgcgcgat
gagcgtaataatattctgttaaagcgtacgccagacggtggtgagaccctgttcgagtgg
gtggataaccaactggtggcagagaccgacccgctgggtggccgcacggcgtatcagcgc
aatgactgggggcaggtgactgaggttgctttgccggacggcgccacacatcagtatgcg
tatgatgaaaacgggcaactgttggcctataccgacccgctgtgcagcgaatggcactac
cagcgtaatgcggctgggcaggttgtggaggtgaacgacccggaaggccgtgagtggctg
tattcttatggagaaacgggacagctggcgacggtgataggcccggacggcgtgttgcag
cgttatcactataaccgccgtggcctgctgagcagccttgaacgggataatgcactacca
gtgatgtttcggtatgacgaccttgaccgcctgactgagcgacatatcgggcatgaggcg
ggcgtgcaagttcggcgttgggagtatgactgtgtacgtgagtcaccgtcgaaagtggta
tacgaagacggcagcgagacgcagtttggctatgatgtggaaggtaacctgacggctgtg
acggatgcgctgggccagcgttaccaattccgctatggggcgttcgataacctgctggaa
gcgacggacccgctgggggcgacggtacgctaccactacaatgcggaagcggaattcgcc
ggagtgacgaacagtcagggacgggactggacgtacggctttgatcacagcggacggctg
agtgaggagcggcattacgacggccgggtataccgctatcgctacgatgtggcagaccgt
ctggtgcaacgcacggcaccggatggcagcgctcttcattatgaacatgatacggcaggg
cggataacgcgtatcacggcgcggagagcggacggggaaacggacggcatcaccgagctg
gaatatgatgttgccggtaggctgacccaagccgccagcccggatgcggtggtggaatac
gtctataaccgggcgggccaggtgacgtcggagacggtcaacggcgaggcggtgcagagt
ggctatgacgcgggcggtcagcgtgcgattgtcgacggtattctggcgccactgcagctg
gcatggcagtcggggcggctgtcgtcgctgggcattggttcacaccagccgttgcagttt
agccatacggcggcgggcgaagagcagcgacgcagtaacggcagcggatttgcattgcgc
cacgagtggagcccgacggggttgctgcagcgtcaggcgctggaaggagcggacgggcgg
gtgaatgacgtgctggagcgtcgttatcagtacgatgtactggaccgtctgacaggtatc
accgacagccactggggtgagcaggccttccggctgaacggggccggccagatgacggca
gagcgccgtgatgagggacgtcggcgtcaggcacggctgtttggctacgacagcgaacag
aatttgtgcgaggtgtcgcagatagcgccgggtctggatgagacgctgaaggtgcaggat
gcggtggtgcagtcgtcggcgcggtacgatgcggcaggccgggtaatcgagcggggccat
acgcagtaccggtatgatgactgcgggcgtctggcgatgaaacgggaaacgcgtccgggg
ttcaggccgaaggaaacgtatttcgactgggacgtacaggaccgactggtacgggtgagt
ctgccggacggggcgcggtggcgctatcgttacgatgcgtttggtcgcagaatcaataag
gtgcgcgaggggcaggtgccgtcggcgcaggcggtagcgcgggtggcgtaccggtgggac
ggcgaccaactgattggtcagcatcaataccgggcagacggctccgcggcgcgggaagta
cagtgggtgtacgagccggggagcttccggccgctggcgcagctggaggcgcagggcgac
agcacacagctgcactacatcgtcactgacctgacaggaaccgcgagagagctgtgcagc
gaggaaggggaaatccgctggcgcggcgaacagggcttgtggggggcgcatcgtgaagag
cgacggcccatcccgctgcggcgctacctgggggatgcggcgaatgaagaagtgtactgc
gagctgcgctatcagggtcagctgtacgatgctgaaacggggctttactacaaccgtcat
cgttactatgatgcggagagcggacagtatctgtcgccggacccgatagggttagcggga
ggcaaaagggcatatggttatgtaaaaaatccgctcagttgggtagatcctcttgggttg
acgcccaaagagggaaaaaatggttctgataaaggccctgataaaaaaaactcaagagca
aaaataaataatatcgaggatatctttgataacccggatgttcttaaaggacatacacca
gaatcattaaaagaagaactaggtggtattccagaaggttggaaggctgggacaatgaat
aaatccagaacagaagatggctttacacttcgcgagttaaatgaacggggtaatgatgtt
actgatagatatattcagtatcacccagggtcgcgaagacattatgacggagcaccatat
tggaaagtgtcttctggtaaaaatggtacagttagattccctgcggagatcgattga

DBGET integrated database retrieval system