KEGG   Pectobacterium atrosepticum SCRI1043: ECA4141Help
Entry
ECA4141           CDS       T00186                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00564  Glycerophospholipid metabolism
eca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECA4141 (glpD)
Enzymes [BR:eca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECA4141 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 3HCDH_N FAD_binding_3 FAD_oxidored GIDA HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAG77038
GeneDB: ECA4141
UniProt: Q6CZL0
LinkDB All DBs
Position
4622349..4623851
Genome map
AA seq 500 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALSERETLLKMAPHIIFPMRFRLPHQPHLRPAWMIRIGLFMYDNIGKRVSLPAS
KGLKFGADSVLKPELKQGFEYSDCWVDDARLVVLNAQEVAKRGGEVRTRTKVTRARREQG
VWIVDAVDSLTGETFTWRAKGLVNATGPWVKEFFDDGLQLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNKDHRIVFVIPWQDDYSIIGTTDVEYKGNPHDVKIDDNEVGYLLDVYNDHF
KQQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVDDDNGQAPLLSVFGGKLTTYRK
LAEHALDKLHKYYPQAGKAWTKDAVLPGGDIAGTRDDYAAALRRRFNLPESLTRRYSRTY
GSNSELILANVKGLSDLGEDFGHDLYEAELRYLVEKEWAVTLDDVIWRRTKLGMRFDDAQ
KQRISDWLVSYRQQQMAKAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctcatcgttatcggcggcggaattaacggtgcaggcatcgccgca
gatgcggctgggcgagggctatcagtcctgttgttggaagcgcaggatcttgcctgtgcc
acgtcctctgccagctctaagctgattcacggcggcctgcgctaccttgagcactatgag
tttcgtttggtcagcgaagcactgtctgaacgcgaaacgctgctgaaaatggctccgcac
attattttcccaatgcgctttcgtttgccccatcagccgcacctgcgtccagcctggatg
attcgtatcggcctgttcatgtatgacaacattggcaaacgcgtcagcctgcctgccagt
aagggactgaaattcggtgcagattccgttcttaagcctgagttgaagcaaggctttgaa
tattctgactgctgggtggacgatgcgcgtctagtggtgttaaacgcgcaggaagtggca
aaacgcggcggagaagtccgcacccgcaccaaagttacccgcgctcgccgtgaacaaggc
gtgtggattgtggatgccgttgactcactgaccggcgaaaccttcacctggcgtgccaaa
ggcctggtgaatgcgaccggcccgtgggtgaaagaattctttgatgacggcttacagctg
aaatcgccttacggcatccgtttgatcaaaggcagccacatcgtggtgccaagagtccat
aaccagccgcaggcgtatattctgcaaaacaaagatcaccgtattgtattcgtgatcccg
tggcaggatgactactcgatcatcggtacgaccgacgtagagtacaaaggtaatccgcac
gatgtgaagatcgatgacaacgaagtcggctacctgctggatgtgtataacgaccatttc
aaacagcaacttacgcgtgacgatatcgtctggacttactccggcgtgcgcccactgtgc
gatgacgagtccgattctccacaggcgattacccgtgattacacgctgtcggtagacgat
gacaacggtcaggctccactgctttccgtgtttggcggcaagctgacgacgtaccgtaaa
ctggcagagcacgcgctggacaagctccacaaatactatcctcaggcgggtaaagcctgg
acgaaagatgcggtactgccgggcggtgatatcgctggcacgcgtgatgactacgccgcc
gcgctgcgtcgccgcttcaatctgcctgaatcactgacgcgccgttacagccgtacctac
ggttcaaacagcgaactgattctggcaaacgtgaaaggcctcagcgatctgggtgaagat
ttcggtcatgacctgtatgaagccgaactgcgctatttggtcgagaaagaatgggcggtc
acgctggacgacgtcatctggcgccgcaccaaactgggcatgcgctttgatgacgcgcag
aaacaacgcatcagcgactggttagtcagctaccgccaacaacagatggcaaaagcgggt
taa

DBGET integrated database retrieval system