KEGG   Equus caballus (horse): 100049851Help
Entry
100049851         CDS       T01058                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00500  Starch and sucrose metabolism
ecb01100  Metabolic pathways
ecb04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100049851
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100049851
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100049851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100049851
NCBI-ProteinID: XP_001487909
Ensembl: ENSECAG00000019367
UniProt: F7DYB1
LinkDB All DBs
Position
5
AA seq 511 aa AA seqDB search
MKFLLLLSAIGFCWAQYDPHTQSGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENIVVNNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVVNHMCGS
GGGAGTSSTCGSYYNAGSRDFPAVPYSGWDFNDGKCNSGSGEVENYNDIYQVRDCRVVGL
LDLALEKDYVRSTIADYLNHLIDLGVAGFRLDAAKHMWPGDIKAFLDKLHNLNTNWFPQG
SKPFIYQEVIDLGTEPIKGSEYFGNGRVTEFKYGAKLGTVLRRWDGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMAVGFMLAHPYGFTRIMSSYRWA
RNFQNGQDANDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVDGQA
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWALSSTLQTGLPGGTYCDVISGDKVDGNCTGI
KIYVSSDGSAYFSISNTAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccttctgttactttcagccattgggttctgctgggctcagtatgacccacat
acccaaagtggacggacatctattgtccatctgtttgagtggcgctgggttgatattgct
cttgaatgtgagcgatacttagctcccaaaggatttggaggggttcaggtctctccaccc
aatgaaaatatcgtagttaataacccttcaagaccttggtgggaaagataccaaccaatt
agctacaagatatgtacaagatctggaaatgaagatgaatttcgagacatggtgaccaga
tgtaacaacgttggtgttcgtatttatgtggatgctgtagttaatcatatgtgcggaagt
ggtggcggtgcaggaacgagcagtacttgtggaagttactacaatgctggaagtagggac
tttccagcagtcccatactctggttgggattttaatgatggtaaatgtaactctggaagt
ggcgaggttgagaactataatgatatctaccaggtcagagattgtcgcgtggttggtctt
cttgatcttgcgctggagaaagattatgtgcgttccacgattgctgactatctgaatcat
ctcatcgacttgggtgtagcagggttcagattggatgctgctaagcacatgtggcctgga
gacataaaggcttttttggataaactgcataatctaaacacaaactggttccctcaagga
agtaaacctttcatttaccaggaggtaattgatctgggtactgagccaattaaaggcagc
gagtactttggaaatggccgtgtgacagaattcaagtatggtgctaaactaggcacagtt
ctgcgcaggtgggatggagagaagatggcatacttaaagaactggggagaaggctggggt
ttcatgccttcagacagagcacttgtctttgtggataaccatgacaatcagcgaggacat
ggagctggaggagcgtctattcttacattctgggactctagactgtacaaaatggcagtt
ggatttatgctggctcatccttatggatttacaagaataatgtcaagctaccgttgggca
agaaattttcagaatggacaagatgctaatgattggattgggccaccaaataataatggt
gtgattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
caccgatggcgtcaaataaggaacatggttgcgttccgtaatgtagttgatggccaagct
tttacaaactggtgggataatggtagcaaccaagtagcttttggaagaggaaacagagga
ttcattgtctttaacaatgatgactgggcattgtcttcaactttgcaaactggtcttcct
gggggcacatattgtgacgttatttctggagataaagttgatggcaattgtacaggaatt
aaaatctatgtttccagtgatggcagtgcttacttttctattagtaacactgctgaagat
ccatttattgctattcatgctgaatcaaaattgtaa

DBGET integrated database retrieval system