KEGG   Equus caballus (horse): 100050855
Entry
100050855         CDS       T01058                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04015  Rap1 signaling pathway
ecb04062  Chemokine signaling pathway
ecb04510  Focal adhesion
ecb04666  Fc gamma R-mediated phagocytosis
ecb04722  Neurotrophin signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04935  Growth hormone synthesis, secretion and action
ecb05100  Bacterial invasion of epithelial cells
ecb05135  Yersinia infection
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100050855 (CRKL)
   04012 ErbB signaling pathway
    100050855 (CRKL)
   04015 Rap1 signaling pathway
    100050855 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100050855 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100050855 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100050855 (CRKL)
   04062 Chemokine signaling pathway
    100050855 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100050855 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    100050855 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100050855 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100050855 (CRKL)
   05206 MicroRNAs in cancer
    100050855 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100050855 (CRKL)
   05211 Renal cell carcinoma
    100050855 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100050855 (CRKL)
   05100 Bacterial invasion of epithelial cells
    100050855 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100050855 (CRKL)
   05163 Human cytomegalovirus infection
    100050855 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ecb04990]
    100050855 (CRKL)
Domain-containing proteins not elsewhere classified [BR:ecb04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100050855 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 100050855
NCBI-ProteinID: XP_005612427
Ensembl: ENSECAG00000017629
VGNC: 16869
UniProt: A0A3Q2H3L6
LinkDB
Position
8
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPSLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSTTPGAAINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcagaccgctccgcctggtacatggggccggtgtcg
cgccaggaggcgcagacccggctccaaggccagcgccacggcatgttcctggtccgcgac
tcctccacctgccccggggactatgtgctgtccgtgtccgagaactcgcgcgtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggagtttgatcac
ttgccggccctgctggagttctacaagatccattacctggacaccaccaccctcatcgag
cccgcgcccaggtatccgagcccaccaatgggatctgtatcagcacccagcctgcctaca
gcagaagaaaatctggaatatgtacggactctctatgattttcctgggaatgatgccgaa
gacctgccctttaagaagggtgagatcctggtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaagatggccgggttgggatgattcccgtcccttatgttgaaaag
ctcgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttacgggatc
ccagaacctgctcatgcatatgctcaacctcagaccacaactcctctacctgcagtttcc
actactcctggggcagcgatcaaccctttgccatccacacagaacggacctgtctttgca
aaagcaatccagaaacgagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacattgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaagtgaat
gggcgcaaagggcttttcccctttacacacgtcaaaatcattgaccctcaaaacccggat
gaaaatgagtga

KEGG   Equus caballus (horse): 100072356
Entry
100072356         CDS       T01058                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04015  Rap1 signaling pathway
ecb04062  Chemokine signaling pathway
ecb04510  Focal adhesion
ecb04666  Fc gamma R-mediated phagocytosis
ecb04722  Neurotrophin signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04935  Growth hormone synthesis, secretion and action
ecb05100  Bacterial invasion of epithelial cells
ecb05135  Yersinia infection
ecb05163  Human cytomegalovirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05206  MicroRNAs in cancer
ecb05211  Renal cell carcinoma
ecb05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100072356 (CRK)
   04012 ErbB signaling pathway
    100072356 (CRK)
   04015 Rap1 signaling pathway
    100072356 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100072356 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100072356 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100072356 (CRK)
   04062 Chemokine signaling pathway
    100072356 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100072356 (CRK)
   04935 Growth hormone synthesis, secretion and action
    100072356 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100072356 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100072356 (CRK)
   05206 MicroRNAs in cancer
    100072356 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100072356 (CRK)
   05211 Renal cell carcinoma
    100072356 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100072356 (CRK)
   05100 Bacterial invasion of epithelial cells
    100072356 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100072356 (CRK)
   05163 Human cytomegalovirus infection
    100072356 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ecb04990]
    100072356 (CRK)
Domain-containing proteins not elsewhere classified [BR:ecb04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100072356 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 100072356
NCBI-ProteinID: XP_023508964
VGNC: 51791
LinkDB
Position
11
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPLPPSPAQPPPGMSTSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactggggacggctgagccgg
caggaggcggtggcgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccgctgccgccgtcgcccgcccagcctccgccc
ggaatgagcacctccagactccgaataggcgatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacattaatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgagccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagaggggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccattgggtgggccggagcccgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcctgat
gaggacttcagctga

DBGET integrated database retrieval system