KEGG   Equus caballus (horse): 100050883
Entry
100050883         CDS       T01058                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100050883 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ecb04054]
    100050883 (NLRP4)
Membrane trafficking [BR:ecb04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100050883 (NLRP4)
Pattern recognition receptors [BR:ecb04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100050883 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 VirE AAA_16 AAA_25 DUF4274
Other DBs
NCBI-GeneID: 100050883
NCBI-ProteinID: XP_001496677
Ensembl: ENSECAG00000020602
VGNC: 20769
LinkDB
Position
10
AA seq 984 aa
MASSFFSDFGLLWYLGELKKDEFRKFKDFLKQEPLQLGLKPIPWAEVRKATREGLANLLV
KHYEEQEAWNVTFSIFHKIHRKDLCEKAKKEITGHTKTYQAHIQEKFNNMWFRESVTRIH
DYFDQKTTQKERESLERLFAPKETGKQPRTVVFKGIQGIGKTTFLIKLMLAWAEGSLYQE
RFFYVFYFCCREMKQLTQTSLAALISRDWPNSHVPLTEIMSQPERLLFVIDSFEELKHNL
DEPESDLCSDWMEQRPVRVLLSSLLRKKMLPECSLLIAAAPVYPGEIEDRLVCPEIKTFL
GFSESERKQYFCCIFQDRNRAMEAFSFVRENEQLFCMCQIPTLCWIVCTCLKHEMERGKD
LALTCRRTTSLYTSFIFNLFTAKGTSCPDQQSQSQLKGLCSLAAEGMWTDTFVFSEEDLR
RNGLVDSDIPTLLDMKALQKYRECENSYLFIHVCVQEFCAAMFYFLKSHIDHPNPAVGCT
ETLLFTYLKKVKVHWIYLGCFMFGLLNEKEQQKLDAFFGFHLSQEIQQKFRQCVQRIGES
EHLQGEVDFLALCYCLFEMQNEAFVKWAMALFQDVTFSIVDSADLVTSAYCLKHCSRLRK
LWLSIQNVFKEENANNPTSNYSFICWHHVCSVLTTNENLTELQVSDSSLNESAFVTLCNQ
LRHPSCHLQKLWINNVSFSAESWFFFEVLTLSPDLKYLNLNGTALSRKDVKLLCNALSNP
KCNVEELLLTNCCLSADDCEAFTWVLNSNNKLKLLNVSYNYLDKGVPLLCKALRHPDCAL
EVLVLGYCYLSGHCWKSLSDALLCNKSLVHLDLSANVLKYEELKLLCEALKQPSCQLQSL
CLLKCCITARGCQDLASVLTSNQNLTGLQIGYNDIEDVGAKLLCEALTHPQCRLENLGLG
ACKLTSACCEDLSSALTSSKTLRRLNLSGNALDHGGVVVLCEALRCPECPLQVLGLKKDE
FDEETQRLLMAEEERNPHLTIFSG
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggcgtcatctttcttttctgattttggccttctgtggtacctgggggagctcaaaaag
gatgagttcagaaaatttaaggatttcctcaaacaagagcctctgcaactcggactcaag
ccaattccctgggctgaagtaaggaaggcaacccgggaaggacttgctaacctattggtc
aaacattatgaggaacaagaagcatggaatgtgaccttcagcatctttcacaagatccat
agaaaggatctctgtgagaaggccaagaaagagattacaggacacaccaagacatatcaa
gctcatatacaggagaagttcaacaatatgtggttcagagaatctgtcactaggattcat
gactactttgaccagaaaaccacccagaaagaacgtgagtctttggaacgtctttttgcc
cctaaggaaactggaaaacagccacgaacagtggtctttaaaggaatacaagggataggg
aaaacgacgtttctgatcaagttgatgttggcctgggcagagggcagcctctatcaggag
agattcttttatgttttctacttctgctgccgggaaatgaagcagttgacacagacaagc
ttggcagcgctgatttctagagactggcccaactcccatgttccactaacggagatcatg
tcccagccagagagactcttgttcgtcattgatagctttgaagaactgaaacacaacctg
gatgaacctgagtcagatctgtgcagcgactggatggagcagcgaccagtacgggtgctc
ctgagtagcttgttgaggaagaaaatgctccccgagtgctcactgctcattgcagctgca
cctgtgtacccaggggaaattgaggataggttggtgtgcccagaaattaaaacattcctg
ggattcagtgagagtgagaggaagcagtacttctgctgtatatttcaagacaggaataga
gccatggaagccttcagttttgtaagagaaaatgaacaactgttttgcatgtgccaaatc
cccaccctttgctggattgtgtgcacttgtctgaagcacgagatggaaagggggaaagat
ctggcactgacctgccgacgtaccacctctctttatacttctttcatctttaacttgttc
acagccaagggcactagttgtccagatcagcaaagccaaagccagttgaagggcttgtgt
tccctggctgcagagggcatgtggaccgacacgtttgtatttagtgaagaggatcttagg
agaaatgggttagtggattctgacattcctacattgctggacatgaaggctcttcagaag
tacagagaatgtgagaactcatacctgttcatccatgtgtgtgtccaggagttctgtgcc
gccatgttctattttctgaagagccacatcgaccatccaaacccagctgttggatgtaca
gagacactactatttacctatttaaagaaagtaaaagtacattggatttatttggggtgt
ttcatgtttggccttttaaatgaaaaggagcaacaaaagctggatgcgttttttggcttc
cacctgtcccaagagatacagcagaaatttcgccagtgtgtgcagcgcataggtgagagt
gaacatcttcaaggagaggtggatttcttggcattgtgttactgtttgtttgagatgcag
aacgaagcctttgtaaagtgggcaatggccctcttccaagacgttacattttctattgtt
gacagtgcagatttggtgacttctgcctactgcttaaaacactgttctcgcttgaggaaa
ctttggctttccatccaaaatgtctttaaagaagagaatgcaaacaaccccacgtcaaat
tacagtttcatctgttggcatcatgtctgctctgtgctcactacaaatgagaacctcaca
gaactccaagtgagtgacagcagcctcaacgagtcagcctttgtgactttgtgtaatcag
ctgaggcatcccagctgtcaccttcaaaagctttggataaataacgtttccttctctgct
gagagttggtttttctttgaggtgctcacgcttagcccggatttgaaatacctgaacctc
aatggcacagccctctcccgtaaggatgtgaagttgctctgtaacgccttgagcaatcca
aagtgcaacgtggaggaactgctgctgacaaattgttgcctttcagctgatgattgtgaa
gccttcacctgggtcttaaacagcaacaacaagctgaagcttcttaacgtatcatacaac
tacttggacaaaggcgtgcccctgttgtgtaaggccctgcgccacccagactgcgctctg
gaggtcttggtcttgggttactgctacctcagtggacactgctggaaaagcctctctgat
gctcttctgtgtaacaagagcttggtccatctagacctcagcgcaaatgtcctgaaatat
gaagaactgaaacttctctgcgaggccttgaaacagccaagctgccaactacagtcgctg
tgtttattaaaatgttgtatcactgcccgtggctgtcaagaccttgcctcagtcctcacc
agcaaccaaaacctgacaggtctgcaaattgggtacaacgatatagaagatgtcggtgcg
aagctgttgtgcgaagctctgacacatccccaatgtcgcttagagaatcttgggctgggt
gcgtgcaagttaactagtgcctgctgcgaggatctctcttctgctctcaccagcagtaaa
actctgagaagactgaacctcagtggaaacgccttggaccacggtggggtggtggtgctg
tgtgaggccctgagatgcccagagtgccccctgcaggttctcgggctgaaaaaagatgaa
tttgatgaggaaacccagagacttctgatggctgaagaagagagaaatccccacttgaca
attttcagtggctaa

DBGET integrated database retrieval system