KEGG   Equus caballus (horse): 100053178Help
Entry
100053178         CDS       T01058                                 

Gene name
ATP5F1A
Definition
(RefSeq) ATP synthase subunit alpha, mitochondrial
  KO
K02132  F-type H+-transporting ATPase subunit alpha
Organism
ecb  Equus caballus (horse)
Pathway
ecb00190  Oxidative phosphorylation
ecb01100  Metabolic pathways
ecb04714  Thermogenesis
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05016  Huntington disease
Module
ecb_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100053178 (ATP5F1A)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100053178 (ATP5F1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100053178 (ATP5F1A)
   05012 Parkinson disease
    100053178 (ATP5F1A)
   05016 Huntington disease
    100053178 (ATP5F1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N DUF4142 Rotavirus_VP1
Motif
Other DBs
NCBI-GeneID: 100053178
NCBI-ProteinID: XP_005612929
Ensembl: ENSECAG00000021561
VGNC: 15659
UniProt: F6XUJ2
LinkDB All DBs
Position
8
AA seq 553 aa AA seqDB search
MLSVRVAAAVARALPRRAGLVSRNALGSSFIAARNLHASNTRLQKTGTAEMSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYAPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFESAFLAHVISQHQALLGTIRTDGKISEQSDAKL
KEIVTNFLAGFEA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctgtgcgcgtcgccgcggccgtggcccgcgccctccctcgtcgggccgggctg
gtctccagaaatgctttgggatcatccttcattgctgcaaggaacctccatgcctctaat
actcgtcttcagaagactggcactgctgagatgtcctctattcttgaagagcgtattctt
ggagctgatacctctgttgatcttgaagagactgggcgtgtcttaagtattggagatggt
attgcccgtgtacatgggctgagaaatgttcaagcagaagaaatggtagagttttcttca
ggtttaaagggtatgtctctgaacttggaacctgacaatgttggtgttgtcgtgtttgga
aatgataaactaattaaggaaggagatattgtgaagagaacaggagccattgtggatgtt
ccagttggcgaggagctgttaggtcgcgtagtagatgcccttggtaatgccattgatgga
aagggtccaattggttctaagacccgaaggcgagttggcctgaaagcccctgggatcatt
cctcgaatctctgtgcgggagcccatgcagactggcattaaggctgtggatagcttggtg
ccaattggtcgtggtcagcgtgagctgattattggtgaccgacagactggcaaaacatca
attgctattgacacaatcatcaaccagaagcgtttcaatgacggaactgatgaaaagaag
aagctgtactgtatctatgttgctattggtcaaaagagatccactgtcgcccagttggtg
aagagacttacagatgcagatgccatgaagtacaccattgtggtttcagctactgcttct
gatgctgctccacttcagtacttggctccttattctggctgttctatgggagaatatttc
agggataatggcaaacatgctttgatcatctatgacgacttatccaaacaggctgttgct
taccgtcagatgtccctgctgctccgccgaccccctggtcgtgaggcctatcctggtgat
gtgttctacctgcactcccgtctgctagagagagcagccaaaatgaatgatgcttttggt
ggtggctccttgactgctttaccagtcatagaaacacaagctggtgatgtgtctgcttac
attccaacaaatgtcatctccatcactgatggacagatcttcttggaaacagaattgttt
tacaaaggtattcgccctgccattaacgttggtttgtctgtgtctcgcgtcggatctgct
gcccaaaccagggccatgaagcaggtggcaggtaccatgaagctggaattggctcagtat
cgtgaggttgctgcttttgcccagttcggttctgaccttgatgctgccacgcaacaactc
ttaagccgtggtgtgcgtctgactgagttgctgaagcaaggacagtatgctcccatggct
attgaggaacaagtggctgttatctatgctggcgtaagggggtatcttgataaactggag
cccagcaagatcacaaagtttgagagtgccttcttggctcatgttatcagccaacaccaa
gccctgttgggcactatcaggactgatggaaagatctcagaacagtcagatgcaaagctg
aaagagattgtgacaaacttcttggccggatttgaagcttaa

DBGET integrated database retrieval system