KEGG   Equus caballus (horse): 100054996
Entry
100054996         CDS       T01058                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04210  Apoptosis
ecb04218  Cellular senescence
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100054996 (GADD45G)
   04064 NF-kappa B signaling pathway
    100054996 (GADD45G)
   04068 FoxO signaling pathway
    100054996 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100054996 (GADD45G)
   04210 Apoptosis
    100054996 (GADD45G)
   04115 p53 signaling pathway
    100054996 (GADD45G)
   04218 Cellular senescence
    100054996 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100054996 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100054996 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100054996 (GADD45G)
   05212 Pancreatic cancer
    100054996 (GADD45G)
   05225 Hepatocellular carcinoma
    100054996 (GADD45G)
   05226 Gastric cancer
    100054996 (GADD45G)
   05214 Glioma
    100054996 (GADD45G)
   05216 Thyroid cancer
    100054996 (GADD45G)
   05220 Chronic myeloid leukemia
    100054996 (GADD45G)
   05217 Basal cell carcinoma
    100054996 (GADD45G)
   05218 Melanoma
    100054996 (GADD45G)
   05213 Endometrial cancer
    100054996 (GADD45G)
   05224 Breast cancer
    100054996 (GADD45G)
   05222 Small cell lung cancer
    100054996 (GADD45G)
   05223 Non-small cell lung cancer
    100054996 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100054996 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100054996 (GADD45G)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100054996 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100054996 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100054996
NCBI-ProteinID: XP_001917932
Ensembl: ENSECAG00000023399
VGNC: 18209
LinkDB
Position
23
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSALRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENHIDIVRVGDVQRLAAIVGAGDEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagttcgcggccaggatacagttccggaaagcacggccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctatcggcgctgcgccagggctgcctcacc
gccggcgtctacgagtccgccaaagtcctgaacgtggaccccgacaacgtgaccttttgc
gtcctggccgccgacgaggaggacgaaggcgacatcgcgctgcagatccacttcacgctg
atccaggcgttctgctgcgagaaccacatcgacatcgtgcgcgtgggcgacgtgcagcgg
ctggcggcgatcgtgggcgccggcgacgaggcgggcgcgccgggagatctgcactgcatc
ctcatctcgaaccccaatgaggacgcgtggaaggaccctgccttggagaagctcagcttg
ttctgcgaggagagccgcagcgtcaacgactgggtgcccagtatcactctccccgagtga

KEGG   Equus caballus (horse): 100059768
Entry
100059768         CDS       T01058                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04210  Apoptosis
ecb04218  Cellular senescence
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100059768 (GADD45B)
   04064 NF-kappa B signaling pathway
    100059768 (GADD45B)
   04068 FoxO signaling pathway
    100059768 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100059768 (GADD45B)
   04210 Apoptosis
    100059768 (GADD45B)
   04115 p53 signaling pathway
    100059768 (GADD45B)
   04218 Cellular senescence
    100059768 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100059768 (GADD45B)
   05202 Transcriptional misregulation in cancer
    100059768 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100059768 (GADD45B)
   05212 Pancreatic cancer
    100059768 (GADD45B)
   05225 Hepatocellular carcinoma
    100059768 (GADD45B)
   05226 Gastric cancer
    100059768 (GADD45B)
   05214 Glioma
    100059768 (GADD45B)
   05216 Thyroid cancer
    100059768 (GADD45B)
   05220 Chronic myeloid leukemia
    100059768 (GADD45B)
   05217 Basal cell carcinoma
    100059768 (GADD45B)
   05218 Melanoma
    100059768 (GADD45B)
   05213 Endometrial cancer
    100059768 (GADD45B)
   05224 Breast cancer
    100059768 (GADD45B)
   05222 Small cell lung cancer
    100059768 (GADD45B)
   05223 Non-small cell lung cancer
    100059768 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100059768 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100059768 (GADD45B)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100059768 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100059768 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100059768
NCBI-ProteinID: XP_001493871
Ensembl: ENSECAG00000009168
VGNC: 18208
LinkDB
Position
7
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgagc
gccgcggtggaggagctgctggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggtcctgtgcctcctggcc
attgacgaggaggaggaggatgacatcgccctgcagatacacttcacgctcatccagtcc
ttttgctgcgacaacgacattaacatcgtgcgggtgtcaggcatgcagcgcctggcacag
ctgctgggcgagccggcggagacccagggtaccaccgaggcgcgggacctgcactgcctc
ctggtcacgaaccctcatacagacgcctggaaaagccacggcctggtggaggtagctagt
tactgcgaagagagccgcggaaacaaccaatgggtcccctacatctctctccaggagcgc
tga

KEGG   Equus caballus (horse): 100630299
Entry
100630299         CDS       T01058                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ecb  Equus caballus (horse)
Pathway
ecb04010  MAPK signaling pathway
ecb04064  NF-kappa B signaling pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04115  p53 signaling pathway
ecb04210  Apoptosis
ecb04218  Cellular senescence
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100630299 (GADD45A)
   04064 NF-kappa B signaling pathway
    100630299 (GADD45A)
   04068 FoxO signaling pathway
    100630299 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100630299 (GADD45A)
   04210 Apoptosis
    100630299 (GADD45A)
   04115 p53 signaling pathway
    100630299 (GADD45A)
   04218 Cellular senescence
    100630299 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100630299 (GADD45A)
   05202 Transcriptional misregulation in cancer
    100630299 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100630299 (GADD45A)
   05212 Pancreatic cancer
    100630299 (GADD45A)
   05225 Hepatocellular carcinoma
    100630299 (GADD45A)
   05226 Gastric cancer
    100630299 (GADD45A)
   05214 Glioma
    100630299 (GADD45A)
   05216 Thyroid cancer
    100630299 (GADD45A)
   05220 Chronic myeloid leukemia
    100630299 (GADD45A)
   05217 Basal cell carcinoma
    100630299 (GADD45A)
   05218 Melanoma
    100630299 (GADD45A)
   05213 Endometrial cancer
    100630299 (GADD45A)
   05224 Breast cancer
    100630299 (GADD45A)
   05222 Small cell lung cancer
    100630299 (GADD45A)
   05223 Non-small cell lung cancer
    100630299 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100630299 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100630299 (GADD45A)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100630299 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100630299 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100630299
NCBI-ProteinID: XP_023497650
VGNC: 50837
LinkDB
Position
5
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLEPDASPAASEGAAQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactctggaggaattctcggctggcgagcagaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctcagcaaagccctgagtcagcgcaccatcacggtcggggtg
tacgaggcggccaagctgctcaatgtcgaccctgataacgtggtgctgtgtctgctggcg
gcggacgaggacgacgacagggatgtggccctgcagatccacttcaccctgatccaggcc
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggccgag
ctcctgctcctggagcccgacgcgagcccggcggccagcgagggcgccgcgcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatcccaatggaaggatcccgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggtgccagtgatt
aacctccctgaacggtga

DBGET integrated database retrieval system