KEGG   Equus caballus (horse): 100067014Help
Entry
100067014         CDS       T01058                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04371  Apelin signaling pathway
ecb05034  Alcoholism
ecb05165  Human papillomavirus infection
ecb05169  Epstein-Barr virus infection
ecb05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100067014 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100067014 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    100067014 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    100067014 (HDAC4)
   05165 Human papillomavirus infection
    100067014 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100067014 (HDAC4)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100067014 (HDAC4)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100067014 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 100067014
NCBI-ProteinID: XP_023498489
LinkDB All DBs
Position
6
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVAAALPLQVAPPAVPMDLRLDHQFSLP
VTEPTLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAP
SSPNNSSGNVSTENGIAPAVPSIPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPA
TGPSAGAAGQQEAERLALPALQQRISLFPGTHLTPYLSTAPLERDGAAAHNPLLQHMVLL
EQPPAQTPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQHLVIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQAL
LEEPYRDRLSGQKEAHALTGVQVKQEPIESDDEEAEPPREAEPGQHQPTEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKTL
IVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGY
LTKQLMGLAGGRIILALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVIEIHSQYWRSLRRPSSTAGHSLVEAQKCETEEAETVTAMASLSVGVKPAEKRPDE
EPMEAEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aaccctgcccgcgtgaaccacatgcccagcacagtggacgtggccgcggcgctgcctttg
caagtcgcccccccggcggtgcccatggacctgcgcctggaccaccagttctcgctgccc
gtgacggagcccaccctgcgggagcagcagctgcagcaggagctcctggccctcaagcag
aagcagcagctccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcgcggcagcacgaggcccagctgcacgagcacatcaaacaacagcaggagctgctggcc
atgaagcaccagcaggagctgctagagcatcagcggaagctggagagacaccgccaggag
caggagctggagaagcagcaccgcgagcagaagctgcagcagctcaagaacaaggagaaa
ggcaaagagagtgccgtggccagcacggaagtgaagatgaagttacaagagtttgtcctc
aacaagaagaaggcgctggcccaccgcaacctgaaccactgcatttccagcgacccccgc
tactggtacgggaaaacgcagcacagttcccttgaccagagctccccgccccagagtggg
gtgtcggcctcctacaaccacccggtcctgggaatgtatgacgccaaagacgacttccct
ctcagaaaaacagcttctgaacccaatctgaagttacggtctaggctaaagcagaaagtg
gccgagagacggagcagccccctgttacgcaggaaagacgggccagtggttactgctctg
aaaaagcgtcccctggatgtcacagactcggcatgcagcagcgccccgggctcggcaccc
agctcgcccaacaacagctccgggaacgtgagcacggagaacgggatcgcgcccgccgtc
cccagcatcccggccgagaccagcttggcgcacagacttgtgactcgggaaggctccgtg
gctccgcttcccctctacacatcaccgtccttgcccaacatcaccctgggacttcctgcc
actggcccttccgctggggcagcaggccagcaggaagctgagcgactcgctctcccagcc
ctccaacagcggatctccctctttcccggcacccacctcacaccatacctgagcacagcg
cccctggagcgggacggcgcggcggctcacaaccccctcctgcagcacatggtcttactg
gagcagccgcctgcacagacgcccctcgtcacagactggtatctttcaggcctgggagca
ctgcccctgcacgcgcagtctctggttggtgcggaccgggtgtccccgtccatccacaag
ctgcggcagcaccgcccgctggggcgcacgcagtcggccccactgccccagaacgcgcag
gccctgcagcacctggtgatccagcagcagcatcagcagttcctggagaagcacaagcag
cagttccagcagcagcagctgcacatgaacaagattatccccaagcccagcgagccggcc
cggcagcccgagagccaccctgaggagacggaggaggagctccgcgagcaccaggccctc
ctggaggagccctaccgggaccggctctccgggcagaaggaggcgcacgcactgaccgga
gtgcaggtgaagcaggagcccatcgagagtgacgatgaggaggccgagcccccgcgggag
gcggagccgggccagcaccagcctacggagcaggagctgctcttcagacagcaagccctc
ctcctggagcagcagcgcatccaccagctgaggaactaccaggcgtccatggaggccgct
ggcatccccgtgtcctttggcggccaccggcctctgtcccgggcacagtcgtctccagcg
tctgccaccttccccatgtctgtgcaggagccccccaccaagccgaggttcaccacaggc
ctggtgtacgacacgctgatgctgaagcaccagtgcacctgcgggaacactaacagccac
ccggagcacgccgggaggatccagagcatctggtcccggctgcaggagaccggcctccga
ggcaaatgtgagtgcatccgtggacggaaggccaccttggaggagctgcagacggtgcat
tcagaggcgcacaccctgctctacggcacaaaccccctcaacaggcagaaactggacagt
aagaaacttctaggctcactcacttcggtgtttgtcaggctgccctgtggtggtgtcggg
gtggacagcgacaccatatggaacgaggtgcactcgtcaggggcagcccgcctggccgtg
ggctgcgtggtggagctggtcttcaaggtggccacgggggagctgaagaatggctttgcc
gtggtccgccccccgggacatcacgcagaagagagcacacccatggggttctgctacttc
aactctgtggccatcgcagccaagcttctccagcaaaggctgaacgtgagcaagaccctc
atcgtggactgggacgtgcaccacggaaatgggacccagcaggcattctacaacgaccca
aatgtcctgtacatctccctacaccgctacgacgacgggaacttcttcccgggcagcggg
gcgcctgacgaggtgggcacagggccgggcgtgggcttcaacgtcaacatggctttcacc
ggcggcctcgacccccccatgggagatgcggagtacctggcggccttcagaacggtggtc
atgcccatcgcgaacgagtttgccccggacgtggtgctggtgtcatcaggcttcgacgct
gtggagggccaccccacgccgctcggcggctacaacctctcagccaaatgtttcgggtac
ctgacgaagcagctgatgggcttggctggcggccggattattctggccctggaggggggc
cacgacctcacggccatttgcgacgcctcggaagcatgtgtttctgctttgctgggaaac
gagcttgatcctctcccagaaaaggttttacagcagagacccaatgctaacgctgtccgg
tccatggagaaggtcattgaaatccacagccagtactggcgctcgctgcggcggccctcc
tccacggcggggcactcgctcgtcgaggcccagaagtgcgagaccgaggaagccgagacc
gtcaccgccatggcctcgctgtccgtgggcgtgaagccggccgagaagagacccgacgag
gagcccatggaagcggagccgcccctgtag

DBGET integrated database retrieval system