KEGG   Equus caballus (horse): 100069527
Entry
100069527         CDS       T01058                                 

Gene name
RAPGEF1
Definition
(RefSeq) rap guanine nucleotide exchange factor 1 isoform X8
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04510  Focal adhesion
ecb04722  Neurotrophin signaling pathway
ecb04910  Insulin signaling pathway
ecb05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100069527 (RAPGEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100069527 (RAPGEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100069527 (RAPGEF1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100069527 (RAPGEF1)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100069527 (RAPGEF1)
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 100069527
NCBI-ProteinID: XP_001499322
Ensembl: ENSECAG00000018775
VGNC: 22179
LinkDB
Position
25
AA seq 1095 aa
MGNALEKQKPLKRSHLCPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVK
IPEKPVNKEATDRYLPEGYPIPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVS
ALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQSDPRIQHSSALSSCYSRVYQSL
ANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGHPSPTSPVKPS
SPACKPDGQSELPLTDREMEILNKTTSMSQSTELLPDSTDEEVAPPKPPLPGIRVVDNSP
PPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQDFDVDCYAQRRLSGGSHSYG
GESPRLSPCSSIGKLSKSDEQLSSLDRDSGQCSQNTSCETLDHYDPDYEFLQQDLSNADQ
IPQQVACNLSPLPESLGESGSPFLGHSFQLPLGSCPQPEGPLALGQQTDTPPALPEKKRR
SAASQTADSSGCRVSYERHPSQYDNISEDDLQNPASGQSVPFSSFAAILPFQQGGSSASV
EFVGDFTVPESTGDPEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQNEHIYQQK
NKLLMEVYGFNDSFSSGDALQDLAPPPALPPKQRQLESPAVKDGHPRDPPSVGGASGKES
RDGGERASKSPDAPESAQSEEEVDELSLIDHNEIMARLTLKQEGDDGPDVRGGSGDILLV
HATETDRKDLVLYCEAFLTTYRTFITPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVL
VRVVDELCLVELTEEILKLLMELVFRLVCNGELSLARVLRKNILDKVDQKKLLRCANADQ
PLAARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQF
TEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIR
RLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDY
IDGKVNFSKRWQQFNILDSMRCFQQAHYDIRRNDDIINFFNDFSDHLAEEALWELSLKIK
PRNITRRKTDREEKT
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgggcaatgctcttgaaaaacagaagcccctgaaacgaagccatctgtgcccctggaaa
caagactctcagcgttctcatctctcctccttcaccatgaagctgatggacaaattccac
tcacccaaaatcaagagaacgccatcaaagaagggaaaaccagctgaggtgtctgtgaaa
attccggagaagcctgtgaacaaagaggcaacagacagatatctaccagagggctaccct
atccccttggatctggagcagcaggcagtagaatttatgtccaccagtgctgtggcttcc
aggtctcaaaggcagaagaacctgagctggctggaagagaaggagaaggaagttgtcagt
gccttgcgctactttaagaccattgtggacaaaatggctattgataagaaggtactggag
atgcttccagggtcagccagcaaggtgctggaggccatcttgcccctggtgcagagcgat
cctcgaattcaacacagctcagccctctcctcctgctatagcagagtgtaccagagtctt
gccaacctcattcgttggtctgaccaagtgatgctagaaggtgtgaactcagaagataaa
gagatggtgacaactgtgaagggggtcatcaaggctgtgctggatggagtgaaggagctg
gtcagacttaccatcgagaagcaggggcatccgtctccaacaagcccagtgaaacccagt
tccccagcctgcaaacctgacggccagtctgagctccccctgacagatcgagagatggag
attctgaacaagacaaccagcatgtcgcagtcaactgagctactcccagactccacggat
gaagaggtcgcccctcccaagccccccttacctggcattcgggtggttgataatagccct
ccaccagcactgccaccgaagaaaagacagtcggctccatccccgacccgagtggccgtc
gtggcccccatgagtcgagccaccagtggctccagtttgcctgttggaattaataggcag
gattttgacgtggactgttacgcacagaggcggctgtcaggaggcagccactcgtacggc
ggagagtcgccccgcctgtccccctgcagcagcataggcaagctcagcaagtcagacgag
cagctgtcctctctggacagggacagtgggcagtgctcccagaacacaagctgtgaaaca
ctagatcattatgatcctgactacgaattccttcagcaagacctctccaacgcagaccag
atacctcagcaggtggcctgtaaccttagcccgttgccggagtccttgggggagtctggg
tctccatttctcggccattctttccagttgcctctgggcagctgtccccagccggaggga
cccttagccctggggcagcagacagacacgccgcctgctctccctgagaagaagcgcagg
agcgccgcctcccagaccgcggacagctctggctgcagggtgtcctacgagcggcacccc
tcacagtacgacaacatctccgaggacgacctgcagaacccagcctcgggccagtccgtc
cccttctcgtcctttgctgctattctcccctttcagcaaggaggctcctcagcctcggtc
gaatttgtgggtgatttcactgttcctgagtcaacaggtgacccagaaaaaccgcctcct
ctaccagagaagaaaaacaaacacatgctggcctacatgcagctgctcgaggactactcg
gagccgcagccctccatgttctaccagacgccgcagaacgagcacatctaccagcagaag
aacaagctcctcatggaggtgtacggcttcaacgactccttcagcagcggagacgccctg
caggacctggcgccaccgcctgctctgccccccaagcagcggcagctggaatcaccagct
gtgaaagatggacatcccagagatcctccatcagtcggcggtgcatcggggaaggaaagc
agagacggcggggagagggcctcaaagtcaccagatgctccagagtcagctcagtcggag
gaggaagtagacgagctgtccctcatcgaccacaatgaaattatggcaaggctgacactc
aagcaagagggtgacgacgggccagacgtccgtggaggatctggagatatcctactggtc
cacgctactgagacagacaggaaagatttggtgttgtactgtgaggccttcctgaccacc
tacaggacctttatcacccccgaggagctcatcaagaagctgcagtacaggtacgagaag
ttctctcccttcgccgacacgttcaagaagcgcgtcagcaagaacacgttcttcgtgctc
gtgcgggtggtggatgagctctgtctcgtggagttgacggaagagatcttgaagctgctg
atggaactggtctttcgcttggtgtgcaatggggagctcagcctggcccgcgtgcttcgg
aagaacatcctggacaaggtggaccagaagaagctactcaggtgtgccaacgccgaccag
cccctggcagcccggggggtagcagccaggcccgggaccttgcacgactttcacagccac
gaaatagccgagcagctgacactgctggatgctgagctcttttataaaatagagattcct
gaggttttgctttgggcaaaagagcagaacgaggagaagagccccaacttgacccagttc
acggagcacttcaacaacatgtcctactgggtgcggtcaataatcatgttacaggaaaag
gcccaggaccgggaacgcctactcctgaagttcatcaagatcatgaagcacttacggaag
ctgaacaacttcaactcctacctagccatcctctcggcgctggactcggcgcccatccgc
aggctggagtggcagaagcagacctcagagggcctggccgagtactgcacactgattgac
agttcgtcctccttccgcgcctatcgggccgccctgtctgaggtggagccaccgtgcatc
ccgtacctggggctcatcctgcaggacctcaccttcgttcacctgggaaacccagactat
attgatgggaaggtgaatttttccaaacggtggcagcagttcaacatcctcgacagcatg
cggtgcttccagcaggcgcattatgacatccggagaaatgacgacatcataaacttcttc
aacgacttcagtgaccacctggctgaggaggccctgtgggaactctccctgaaaatcaaa
cccaggaacataacaaggaggaaaacagaccgggaagagaagacctag

DBGET integrated database retrieval system