KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1880
Entry
c1880             CDS       T00106                                 

Definition
(GenBank) Putative conserved protein
  KO
K11208  GST-like protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
KEGG Orthology (KO) [BR:ecc00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    c1880
SSDB
Motif
Pfam: GST_C_3 GST_C_2 GST_C GST_C_6
Other DBs
NCBI-ProteinID: AAN80340
UniProt: A0A0H2V8H9
LinkDB
Position
1715196..1715525
AA seq 109 aa
MVWLVANVYPTFTFADYPKRWASDAPEQLKKSVIEYRKSLYIWLNSQLTAEPYVFGEQLT
LVDCYLCTMRTWGPGHEWFQDNAPNINAIVDAVCQIPKLQEVLKRNVII
NT seq 330 nt   +upstreamnt  +downstreamnt
ttggtctggctggttgctaatgtctatccaacgttcactttcgccgattaccctaagcgt
tgggcatctgacgcacctgaacagttaaagaagagtgtaattgaatatcgcaaatcgctt
tatatctggctgaattcgcaattgactgctgaaccgtatgtgtttggagagcaactaacg
ctggtggactgttatctctgcaccatgcgcacatggggaccgggacacgaatggtttcag
gataatgccccgaacattaatgcgattgttgatgctgtatgtcagataccgaaattacaa
gaagtattaaaaaggaatgtcattatttaa

DBGET integrated database retrieval system