KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3343
Entry
Z3343             CDS       T00044                                 

Gene name
stx1B
Definition
(GenBank) shiga-like toxin 1 subunit B encoded within prophage CP-933V
  KO
K11007  shiga toxin subunit B
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece02024  Quorum sensing
ece05130  Pathogenic Escherichia coli infection
Module
ece_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:ece00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Z3343 (stx1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    Z3343 (stx1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ece02042]
    Z3343 (stx1B)
Bacterial toxins [BR:ece02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    Z3343 (stx1B)
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-ProteinID: AAG57227
UniProt: A0A4Q2TQQ4
LinkDB
Structure
PDB: 
1C4Q 1D1I 2XSC 1CQF 1QNU

Position
complement(2995754..2996023)
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system