KEGG   Escherichia coli ATCC 8739: EcolC_3969
Entry
EcolC_3969        CDS       T00697                                 

Definition
(GenBank) excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ecl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EcolC_3969
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecl03400]
    EcolC_3969
DNA repair and recombination proteins [BR:ecl03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EcolC_3969
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      EcolC_3969
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_16 AAA_29 RsgA_GTPase DnaJ_CXXCXGXG AAA_23 AAA_25 cobW NACHT DUF2075 Viral_helicase1 ScfRs
Other DBs
NCBI-ProteinID: ACA79570
LinkDB
Structure
PDB: 
4DFC

Position
4359981..4362803
AA seq 940 aa
MDKIEVRGARTHNLKNINLVIPRDKLIVVTGLSGSGKSSLAFDTLYAEGQRRYVESLSAY
ARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEIHDYLRLLFARVGEPRC
PDHDVPLAAQTVSQMVDNVLSQPEGKRLMLLAPIIKERKGEHTKTLENLASQGYIRARID
GEVCDLSDPPKLELQKKHTIEVVVDRFKVRDDLTQRLAESFETALELSGGTAVVADMDDP
KAEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCDGLGVQQYFDPDRVIQNPEL
SLAGGAIRGWDRRNFYYFQMLKSLADHYKFDVEAPWGSLSANVHKVVLYGSGKENIEFKY
MNDRGDTSIRRHPFEGVLHNMERRYKETESSAVREELAKFISNRPCASCEGTRLRREARH
VYVENTPLPAISDMSIGHAMEFFNNLKLAGQRAKIAEKILKEIGDRLKFLVNVGLNYLTL
SRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIGLHQRDNERLLGTLIHLRDLGNT
VIVVEHDEDAIRAADHVIDIGPGAGVHGGEVVAEGPLEAIMAVPESLTGQYMSGKRKIEV
PKKRVPANPEKVLKLTGARGNNLKDVTLTLPVGLFTCITGVSGSGKSTLINDTLFPIAQR
QLNGATIAEPAPYRDIQGLEHFDKVIDIDQSPIGRTPRSNPATYTGVFTPVRELFAGVPE
SRARGYTPGRFSFNVRGGRCEACQGDGVIKVEMHFLPDIYVPCDQCKGKRYNRETLEIKY
KGKTIHEVLDMTIEEAREFFDAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKL
ARELSKRGTGQTLYILDEPTTGLHFADIQQLLDVLHKLRDQGNTIVVIEHNLDVIKTADW
IVDLGPEGGSGGGEILVSGTPETVAECEASHTARFLKPML
NT seq 2823 nt   +upstreamnt  +downstreamnt
atggataagatcgaagttcggggcgcccgcacccataatctcaaaaacatcaacctcgtt
atcccccgcgacaagctcattgtcgtgaccgggctttcgggttctggcaaatcctcgctc
gctttcgacaccttatatgccgaagggcagcgccgttacgttgaatccctttccgcctac
gcgcggcagtttctgtcactgatggaaaagccggacgtcgatcatattgaggggctttct
cctgccatctcaattgagcagaaatcgacgtctcataacccgcgttctacggtggggaca
atcaccgaaatccacgactatttgcgtttgttgttcgcccgcgttggcgagccgcgctgt
ccggaccacgacgtcccgctggcggcgcaaaccgtcagccagatggtggataacgtgctg
tcgcagccggaaggcaagcgtctgatgctactcgcgccaatcattaaagagcgcaaaggc
gaacacaccaaaacgctggagaacctggcaagccagggctacatccgtgctcgtattgat
ggcgaagtctgcgatctttccgatccgccaaaactggaactgcaaaagaaacataccatt
gaagtggtggttgatcgcttcaaggtgcgtgacgatcttacccaacgtcttgccgagtca
tttgaaaccgcgctggagctttccggtggtaccgcggtagtggcggatatggacgacccg
aaagcggaagagctgctgttctccgccaacttcgcctgcccaatttgcggctacagtatg
cgtgaactggagccgcgactgttttcgtttaacaacccggcgggggcctgcccgacctgc
gacggccttggcgtacagcaatatttcgatcctgatcgagtgatccagaatccggaactg
tcgctggctggtggtgcgatccgtggctgggatcgccgcaacttctattatttccagatg
ctgaaatcgctggcagatcactataagttcgacgtcgaagcgccgtggggcagcctgagc
gcgaacgtgcataaagtggtgttgtacggttctggcaaagaaaacattgaattcaaatac
atgaacgatcgtggcgatacctccattcgtcgtcatccgttcgaaggcgtgctgcataat
atggagcgccgctataaagagacggaatccagcgcggtacgcgaagaattagccaagttt
atcagtaatcgtccgtgcgccagctgcgaagggacgcgtctgcgtcgggaagcgcgccac
gtgtatgtcgagaatacgccgctgcctgctatctccgacatgagcattggtcatgcgatg
gaattcttcaacaatctcaaactcgcaggtcagcgggcgaagattgcagaaaaaatcctt
aaagagatcggcgatcgtctgaaattcctcgttaacgtcggcctgaattacctgacgctt
tcccgctcggcagaaacgctttctggcggtgaagcacagcgtatccgtctggcgagccag
attggtgcgggcctggttggcgttatgtacgtgctggacgagccgtctatcggcctgcac
cagcgtgataacgagcgcctgttgggtacgcttatccatctgcgcgatctcggtaatacc
gtgattgtggtggagcacgacgaagacgcaattcgcgccgctgaccatgtgatcgacatt
ggcccgggcgcaggtgttcacggcggtgaagtggtcgcagaaggtccgctggaagcgatt
atggcggtgccggagtcgttgaccgggcagtacatgagcggcaaacgcaagattgaagtg
ccgaagaaacgcgttccggcgaatccggaaaaagtgctgaagctgacaggcgcacgcggc
aacaacctgaaggacgtgacgctgacgctgccggtgggtctgtttacctgcatcaccggg
gtttcaggttccggtaaatcgacgctgattaacgacacgctgttccctattgcccaacgc
cagttgaatggtgcgaccatcgccgaaccggcaccgtatcgcgatattcaggggctggag
catttcgacaaagtgatcgatatcgaccaaagcccaattggtcgtactccgcgttctaac
ccggcgacctataccggcgtgtttacacctgtgcgcgaactttttgcgggcgtaccggaa
tcccgtgcgcgtggttatacgccaggacgtttcagctttaacgtccgtggcggacgctgc
gaagcctgtcagggcgacggtgtgatcaaagtggagatgcacttcctgccggacatttac
gtaccgtgcgaccagtgtaaaggtaaacgctataaccgtgaaacgctggaaattaagtac
aaaggcaaaaccatccacgaagtgctggatatgaccatcgaagaggcgcgtgagttcttt
gatgccgtacctgcactggcgcgtaagctgcaaacgttgatggacgttggcctgacgtac
attcgcctggggcagtccgcaaccaccctttctggtggtgaagcccagcgcgtgaagctg
gcgcgtgagctgtcaaaacgcggcaccgggcagacactgtatattctcgacgagccgacc
accggtttgcacttcgccgatattcagcaactgctcgacgtgctgcataaactgcgcgat
cagggcaataccattgtggtaattgagcacaatctcgacgtgattaaaaccgctgactgg
attgtcgacctgggaccggaaggcggcagtggcggcggcgagatcctcgtctccggtacg
ccagaaaccgtcgcggagtgcgaagcttcgcatacggcgcgcttcctcaagccgatgctg
taa

DBGET integrated database retrieval system