KEGG   Enterobacter cloacae complex sp. 35734: LI67_002550Help
Entry
LI67_002550       CDS       T04878                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
ecls00480  Glutathione metabolism
ecls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecls00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LI67_002550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecls02000]
    LI67_002550
Enzymes [BR:ecls01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LI67_002550
Transporters [BR:ecls02000]
 Other Transporters
  Pores ion channels [TC:1]
   LI67_002550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: AKZ71638
LinkDB All DBs
Position
1:354121..354792
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNQSRSHRVIWALEELGLPYEIVHYQREKNMLAPEALKKVHPLGKSPVIEDNGL
ILAESGAILEYLQETYDAESRLKPLDPAHKVQYRFWLHYAEGSLMPLLLMKLVFSSLGKP
PVPFGIRTLGKALGQGVQKAYLNRQLETHAHFIESHLAKNSWFAGDSLSMADIQLSFPIF
ALLARGGIDNLPHSQAWKTKVENSPGWQRTLAQGGPLSIPGED
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctcacggtacaccaccttaaccagtcgcgctcgcaccgcgtgatctgggcgctggaa
gaactcggtctgccttatgagatcgttcactatcagcgcgaaaagaacatgcttgcgccg
gaggctctcaaaaaggtgcatccgttgggcaaatcgccggtcatcgaagataacgggctg
atcctcgcggagtctggcgccattctggagtatctgcaggaaacatacgatgccgagtcg
cggcttaagcctttagatccggcgcataaggtgcagtatcgcttctggctgcactacgcg
gaaggatcgctgatgccgctgctgctaatgaagctggtcttcagcagtctcggcaagccg
ccggtgccgtttggtatccgaaccctgggcaaagcgcttgggcagggggtgcagaaagcg
taccttaaccgccagctggaaacccatgcgcactttattgagtcgcaccttgctaaaaac
agctggtttgccggggattcgctcagcatggccgacattcaattgagcttcccgatcttt
gccctgctggcgcgcggcggtatcgacaacctgccgcatagtcaggcatggaaaacgaaa
gttgaaaacagccccggctggcaacgaaccctggcacaagggggaccgttatccatcccg
ggtgaggattga

DBGET integrated database retrieval system