KEGG   Escherichia coli K-12 MG1655: b1513Help
Entry
b1513             CDS       T00007                                 

Gene name
lsrA
Definition
(RefSeq) Autoinducer-2 ABC transporter ATP binding subunit
  KO
K10558  AI-2 transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02024  Quorum sensing
Module
eco_M00219  AI-2 transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b1513 (lsrA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    b1513 (lsrA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b1513 (lsrA)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   AI-2 transporter [MD:M00219]
    b1513 (lsrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 AAA_23 AAA_30 MukB AAA_27
Motif
Other DBs
NCBI-GeneID: 945680
NCBI-ProteinID: NP_416030
Pasteur: ego
RegulonDB: ECK120003389
ECOCYC: G6800
ASAP: ABE-0005056
UniProt: P77257 A0A387D1P0
LinkDB All DBs
Position
1601490..1603025
Genome map
AA seq 511 aa AA seqDB search
MQTSDTRALPLLCARSVYKQYSGVNVLKGIDFTLHQGEVHALLGGNGAGKSTLMKIIAGI
TPADSGTLEIEGNNYVRLTPVHAHQLGIYLVPQEPLLFPSLSIKENILFGLAKKQLSMQK
MKNLLAALGCQFDLHSLAGSLDVADRQMVEILRGLMRDSRILILDEPTASLTPAETERLF
SRLQELLATGVGIVFISHKLPEIRQIADRISVMRDGTIALSGKTSELSTDDIIQAITPAV
REKSLSASQKLWLELPGNRPQHAAGTPVLTLENLTGEGFRNVSLTLNAGEILGLAGLVGA
GRTELAETLYGLRTLRGGRIMLNGKEINKLSTGERLLRGLVYLPEDRQSSGLNLDASLAW
NVCALTHNLRGFWAKTAKDNATLERYRRALNIKFNQPEQAARTLSGGNQQKILIAKCLEA
SPQVLIVDEPTRGVDVSARNDIYQLLRSIAAQNVAVLLISSDLEEIELMADRVYVMHQGE
ITHSALTERDINVETIMRVAFGDSQRQEASC
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgagtgatacccgcgcgttaccgctactttgcgcccgctcggtttataaacag
tattcaggggtcaatgtcctgaaaggcatcgattttacgttgcatcagggggaggtccac
gccctgctcggcggcaatggtgccggtaaatcgacgttaatgaagattattgccggtatt
acccctgctgatagcggtacgctggagattgagggcaacaactacgtcagattaacgcca
gttcatgctcatcagctgggtatttatctcgttccccaggaaccgctgcttttcccaagc
ctgtcgataaaagaaaacatcctgtttgggctggcaaaaaaacagctctccatgcagaaa
atgaagaacttgctggcggcgctgggctgccagtttgatctgcatagtctggcaggatcg
ctggatgtcgccgatcgccaaatggtggaaatcctccgcgggctgatgcgcgactcgcgg
attctgatcctcgatgaacctaccgcctcgcttacccctgcggaaaccgaacgcttgttt
agtcgcttgcaagagctgcttgctactggcgtgggtattgtttttatctcgcataagctg
ccggaaattcgccagattgccgatcgaattagcgtgatgcgcgacggaaccatcgcctta
agcggcaaaaccagcgaactgtctaccgacgacattattcaggccatcaccccagcggta
cgggaaaaatcgctctctgccagccaaaaattatggctggagttacctggtaaccgccca
caacatgccgccggaacgccggtgctgacactggaaaatctgaccggcgaaggtttcagg
aatgtcagcctgacgctcaatgccggagaaattctgggcctggctgggctggtgggggcc
ggacgcacagaactggccgagacgctctatggtctgcgtactttgcgtggcggacgcatt
atgctgaatggtaaagagatcaataaattatccactggagaacgtttactgcgcggtctg
gtttatctgccggaagatcgccagtcatccggactgaatctcgatgcttcgctggcctgg
aacgtctgcgcccttactcataaccttcgtggattctgggcgaaaaccgcgaaagataat
gccaccctggaacgttatcgtcgggcgctgaatattaaattcaaccaaccggaacaagct
gcacggacattatccggtggcaaccagcaaaaaatcctcattgccaaatgcttggaagct
tcgccgcaagtattgattgtcgatgagccgacgcgcggcgtggatgtctcggcccgtaat
gatatctaccagctgttgcgcagcatcgccgcacaaaatgtggctgtgctgcttatctcc
tccgacctggaagagatcgaactgatggcagatcgtgtgtatgtgatgcatcagggcgaa
attacccactctgcactgaccgagcgcgatattaatgtcgagactattatgcgcgttgcc
ttcggcgatagtcagcgtcaggaggcgtcatgctga

DBGET integrated database retrieval system