KEGG   Escherichia coli K-12 MG1655: b3463Help
Entry
b3463             CDS       T00007                                 

Gene name
ftsE
Definition
(RefSeq) cell division protein FtsE
  KO
K09812  cell division transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b3463 (ftsE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eco03036]
    b3463 (ftsE)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3463 (ftsE)
Chromosome and associated proteins [BR:eco03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    b3463 (ftsE)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Cell division transporter
    b3463 (ftsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_16 AAA_25 AAA_23 AAA_30 MMR_HSR1 AAA_22 NTPase_1 AAA_33
Motif
Other DBs
NCBI-GeneID: 947968
NCBI-ProteinID: NP_417920
Pasteur: ftsE
RegulonDB: ECK120000334
ECOCYC: EG10340
ASAP: ABE-0011313
UniProt: P0A9R7
LinkDB All DBs
Position
complement(3602079..3602747)
Genome map
AA seq 222 aa AA seqDB search
MIRFEHVSKAYLGGRQALQGVTFHMQPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIW
FSGHDITRLKNREVPFLRRQIGMIFQDHHLLMDRTVYDNVAIPLIIAGASGDDIRRRVSA
ALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLF
EEFNRVGVTVLMATHDINLISRRSYRMLTLSDGHLHGGVGHE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattcgctttgaacatgtcagcaaggcttatctcggtgggagacaggcgctgcagggc
gttacgttccatatgcagccgggtgagatggcgtttctgaccggtcattccggcgcaggg
aaaagtaccctcctgaagctgatctgtgggattgagcggcccagcgccgggaaaatctgg
tttagcggccatgacatcacgcgtctgaaaaaccgtgaagttccgtttctgcgccgccag
attggcatgattttccaggatcaccatctactgatggaccgtactgtctacgataacgtg
gcgatcccgctgattatcgccggtgccagcggtgacgatattcgtcgccgggtgtcggcg
gcgctggataaagtcgggctactggacaaagcgaagaacttccctattcagctttcgggc
ggtgaacaacagcgtgttggcattgcccgcgcggtggtgaacaagcccgcggtactgctg
gcggacgaaccgactggtaacctggacgacgcgctgtcggaaggcattttacgtctgttt
gaagagtttaaccgcgttggggtaaccgtattgatggcaacgcacgacatcaacctgatc
tcgcggcgttcctatcgcatgctcaccctgagcgatggtcacttgcatggaggcgtgggc
catgaataa

DBGET integrated database retrieval system