KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0229Help
Entry
ECIAI39_0229      CDS       T00829                                 

Gene name
queC
Definition
(RefSeq) 7-cyano-7-deazaguanine synthase QueC
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00790  Folate biosynthesis
ect01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECIAI39_0229 (queC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ect03016]
    ECIAI39_0229 (queC)
Enzymes [BR:ect01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     ECIAI39_0229 (queC)
Transfer RNA biogenesis [BR:ect03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    ECIAI39_0229 (queC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueC Arginosuc_synth Asn_synthase ATP_bind_3 PAPS_reduct ThiI NAD_synthase Diphthami_syn_2
Motif
Other DBs
NCBI-GeneID: 7153284
NCBI-ProteinID: YP_002406273
UniProt: B7NJ50
LinkDB All DBs
Position
262521..263216
Genome map
AA seq 231 aa AA seqDB search
MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDVARELALKLGARAHKV
LDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFLTLAAIYAYQVKAEAVI
TGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWIDKAETWALADYYGKLDL
VRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMAAMKQKTGLK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgctgtcgttgtgttcagtggaggccaggattccaccacctgtctggtgcag
gcattacaacaatatgatgaagtccattgcgtgacgttcgattacggtcagcgacatcgc
gcagaaatcgacgtggcacgcgaactggcgctgaaactgggggcacgcgcgcataaggtt
cttgatgtaacgctgctcaacgagctggcggtcagcagcctgacgcgtgacagcattccg
gtgcctgattatgaacctgaagctgatggcatcccgaatacgtttgtccctgggcgtaat
attttgttcctgacactggcggcaatatatgcgtatcaggtaaaagcagaagccgtaatt
accggcgtctgtgaaacggatttctccggctacccggattgccgcgatgagtttgtgaaa
gcactaaaccatgccgtcagtttgggcatggcgaaagatattcgttttgaaacgccgctg
atgtggattgataaagcggaaacctgggcgctggcagattattacggcaagctggattta
gtccgtaacgaaacgctgacctgttataacggcattaaaggcgacggttgcggtcattgt
gcggcgtgtaatttacgtgccaacggtttgaatcattatctggccgataaaccgacggtg
atggcagcgatgaagcagaaaaccgggttgaagtaa

DBGET integrated database retrieval system