KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_0584Help
Entry
ECIAI39_0584      CDS       T00829                                 

Gene name
ahpF
Definition
(RefSeq) alkyl hydroperoxide reductase F52a subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Brite
KEGG Orthology (KO) [BR:ect00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECIAI39_0584 (ahpF)
Enzymes [BR:ect01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ECIAI39_0584 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 7150706
NCBI-ProteinID: YP_002406610
UniProt: A0A0H3ME84
LinkDB All DBs
Structure
PDB: 

Position
619148..620713
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNSLPV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRHIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaactcaactcaaggcttaccttgagaaattgaccaagcct
gttgagttaattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgcagaactgtcagacaaagtcacctttaaagaagataacagcttgccggtg
cgtaagccgtctttcctgatcactaacccaggttccaaccaggggccacgttttgcagga
tccccgctgggccacgagttcacctcgctggtactggcgttgctgtggaccggtggtcat
ccgtcgaaagaagcgcagtctctgctggagcagattcgccatattgacggtgattttgaa
ttcgaaacctattactcgctctcttgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgagcgtactgaacccgcgcatcaagcacactgcaattgacggcggcaccttccag
aacgaaatcaccgatcgcaacgtgatgggcgttccggcagtgttcgtaaacgggaaagag
tttggtcagggccgcatgacgttgactgaaatcgttgccaaaattgatactggtgcggaa
aaacgtgcggcagaagagctgaacaagcgtgatgcttatgacgtattaatcgtcggttcc
ggtccggcgggtgcagcggcagcaatttactccgcacgtaaaggtatccgtaccggtctg
atgggcgaacgttttggtggtcagatcctcgataccgttgatatcgaaaactacatttct
gtaccgaagactgaagggcagaagctggcaggggcactgaaagttcacgttgatgaatac
gacgttgatgtgatcgacagccagagcgcgagcaaactgatcccggcagcggttgaaggt
ggtctgcatcagattgaaacagcttctggcgcggtactgaaagcacgcagcattatcgtg
gcgaccggtgcaaaatggcgcaacatgaacgttccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaaacgcgtagcggtt
atcggcggcggtaactccggcgtggaagcggcaatcgacctggcgggtatcgttgaacac
gttactctgctggaatttgcgccagaaatgaaagccgaccaggttctgcaggacaaactg
cgcagcctgaaaaacgtcgacatcattctgaatgcgcaaactacggaagtgaaaggcgac
ggcagcaaagtcgttggtctggaatatcgtgatcgtgtcagcggcgatattcacaacatc
gaactggccggtattttcgtccagattggtctgctgccgaacactaactggctggaaggc
gcagtcgaacgtaaccgcatgggtgagattatcattgatgcgaaatgtgaaaccaacgtc
aaaggcgtgttcgcagcgggtgactgtacgacggttccgtacaagcagatcatcatcgct
actggcgaaggtgctaaagcctctctgagtgcttttgactacctgattcgcaccaaaact
gcataa

DBGET integrated database retrieval system