KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1340Help
Entry
ECIAI39_1340      CDS       T00829                                 

Gene name
pheT
Definition
(RefSeq) phenylalanyl-tRNA synthetase subunit beta
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ect00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECIAI39_1340 (pheT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ect01007]
    ECIAI39_1340 (pheT)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ect03016]
    ECIAI39_1340 (pheT)
Enzymes [BR:ect01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     ECIAI39_1340 (pheT)
Amino acid related enzymes [BR:ect01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   ECIAI39_1340 (pheT)
Transfer RNA biogenesis [BR:ect03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ECIAI39_1340 (pheT)
 Prokaryotic type
    ECIAI39_1340 (pheT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B3_4 tRNA_synthFbeta FDX-ACB tRNA_bind B5 PhetRS_B1
Motif
Other DBs
NCBI-GeneID: 7152392
NCBI-ProteinID: YP_002407348
UniProt: A0A0H3MFR2
LinkDB All DBs
Structure
PDB: 

Position
1405216..1407603
Genome map
AA seq 795 aa AA seqDB search
MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFHGVVVGEVVECAQHPNAD
KLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLPGDFKIKAAKLRGEPSEGMLC
SFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA
VLNQLPLVEPEIVPVGATIDDTLPIAVEAPEACPRYLGRVVKGINVKAPTPLWMKEKLRR
CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKLNAD
TLVIADHNKALAMGGIFGGEHSGVNEETQNVLLECAFFSPLSITGRARRHGLHTDASHRY
ERGVDPALQHKAMERATRLLIDICGGEAGPVIDISNEATLPKRATITLRRSKLDRLIGHH
IADEQVTDILRRLGCEVTEGKDEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDEPVQ
ASLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLPSPISVE
MSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPLGIRQDLMLAGVICGNR
YEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGERIG
FVGVVHPELERKLDLNGRTLVFELEWNKLADRVVPQAREISRFPANRRDIAVVVAENVPA
ADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTSRTLEEEEIAATVAK
CVEALKERFQASLRD
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagtgaactgtggttacgcgaatgggtgaacccggcgattgacagcgatgcg
ctggcaaatcaaatcactatggcgggcctggaagttgacggtgtagaaccggttgccggt
agcttccacggcgtggtcgttggtgaagtggttgagtgtgcgcagcatccgaacgctgac
aaactgcgtgtgacaaaagtgaatgtcggcggcgatcgcctgctggacatcgtctgcggt
gcgccaaactgccgtcagggcctgcgtgtggcggtagcgaccattggtgctgttctgccg
ggtgatttcaaaattaaagcggcgaaactgcgtggcgaaccgtcagaagggatgctgtgc
tctttctctgagctgggaatttctgacgatcacagcggtattatcgaactgcctgcggat
gcgccaattggcaccgacattcgtgaatacctgaaactcgatgacaacaccatcgaaatt
agcgtaacgccaaaccgtgccgattgcttaggcattatcggcgtggcgcgtgatgttgcc
gtgctgaaccagctgccgctggttgaaccggaaatcgttccggttggtgcgaccatcgac
gacacgctgccgattgcagtagaagcgccggaagcttgtccgcgctatcttggccgtgtg
gtaaaaggcattaacgttaaagcgccaactccgctgtggatgaaagaaaaactgcgtcgt
tgcgggatccgttctatcgatgcagttgttgacgtcaccaactatgtgctgctcgaactg
ggccagccgatgcacgctttcgataaagatcgcattgaaggcggcattgtggtgcggatg
gcgaaagagggcgaaacgctggtgctgcttgatggcactgaagcgaagctgaatgctgac
actctggtcatcgccgaccacaacaaggcgctggcgatgggcggcatctttggtggcgaa
cattctggcgtaaatgaagaaacgcaaaacgtcctgttggaatgtgctttcttcagcccg
ctatctatcaccggtcgtgctcgtcgtcatggcctgcatactgatgcgtctcaccgttat
gagcgtggcgttgatccggcactgcagcacaaagcgatggaacgtgcgacccgtctgctg
atcgacatctgcggtggtgaggctggtccggtaattgatatcagcaacgaagcaacgctg
ccgaagcgtgcaaccatcactttgcgtcgcagcaaactggatcgcctgattggccatcat
attgccgatgagcaggtcactgacattctgcgtcgtctcggctgcgaagtgaccgaaggc
aaagacgagtggcaggcagttgcgccgagctggcgtttcgacatggagattgaagaagat
ctggtcgaagaagtcgcgcgtgtttacggctacaacaacattccggatgagccggtacag
gcaagcctgattatgggtactcaccgtgaagctgacctgtcgctcaagcgcgtgaaaacg
ctgctcaacgacaaaggctatcaggaagtgatcacctacagcttcgttgatccgaaagtg
cagcagatgatccatccaggcgttgaagccttactgctgccaagccctatttccgttgaa
atgtcagcaatgcgtctttccctgtggactggcctgctggcaaccgtggtgtacaaccag
aaccgtcagcagaaccgtgtgcgcattttcgaaagcggtctgcgtttcgtaccagatact
caggcaccgttgggcattcgtcaggatctgatgttagccggtgtgatttgcggtaaccgt
tacgaagagcactggaacctggcaaaagagaccgttgatttctatgatttgaaaggcgat
cttgaatccgttctcgacctgaccggtaaactgaatgaggttgagttccgtgcagaagcg
aatccggcactgcatccggggcaatccgcagcgatttatctgaaaggtgaacgtattggt
tttgttggggttgttcatcctgaactggaacgtaaactggatcttaacggtcgcactctg
gtgttcgaactggagtggaacaagctcgcagaccgcgtggtgcctcaggcgcgcgagatt
tctcgcttcccggcgaaccgtcgtgacatcgcggtggtggtcgcagaaaacgttcccgca
gcggatattttatccgaatgtaagaaagttggcgtaaatcaggtagttggcgtaaactta
tttgacgtgtaccgcggtaagggtgttgcggaggggtataagagcctcgccataagcctg
atcctgcaagataccagccgtacactcgaagaagaggagattgccgctaccgtcgccaaa
tgtgtagaggcattaaaagagcgattccaggcatcattgagggattga

DBGET integrated database retrieval system