KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1615Help
Entry
ECIAI39_1615      CDS       T00829                                 

Definition
(RefSeq) hypothetical protein
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ost4
Motif
Other DBs
NCBI-GeneID: 7151056
NCBI-ProteinID: YP_002407615
UniProt: A0A0H3MGB9
LinkDB All DBs
Position
1686043..1686207
Genome map
AA seq 54 aa AA seqDB search
MLISDGDYMRLAMPSGNQEPRRDPELKRKAWLAVFLGSALFWVVIALLIWKVWG
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
ttgctgataagtgatggcgattatatgaggttagcaatgccttctggaaatcaggaaccc
cgccgcgatcctgaattaaaacgtaaagcctggctggcggtttttcttggttctgcactt
ttctgggtggttatcgcactgctgatttggaaagtgtggggataa

DBGET integrated database retrieval system