KEGG   Escherichia coli O7 K1 IAI39 (ExPEC): ECIAI39_1713Help
Entry
ECIAI39_1713      CDS       T00829                                 

Gene name
ynbB
Definition
(RefSeq) putative membrane associated CTP-phosphosubstrate transferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
ect  Escherichia coli O7:K1 IAI39 (ExPEC)
Pathway
ect00564  Glycerophospholipid metabolism
ect01100  Metabolic pathways
ect01110  Biosynthesis of secondary metabolites
Module
ect_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ect00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECIAI39_1713 (ynbB)
Enzymes [BR:ect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     ECIAI39_1713 (ynbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_1 CarS-like
Motif
Other DBs
NCBI-GeneID: 7154402
NCBI-ProteinID: YP_002407711
UniProt: A0A0H3MHI3
LinkDB All DBs
Position
1795153..1796049
Genome map
AA seq 298 aa AA seqDB search
MLEKSLATLFALLILATLINRFLIWRLPEGKGGEVTLRIRTWWGIVICFSMVISGPRWMT
LTFFALISFLALKEYCTLISVHFPRWLYWGIPLNYLLIGFNCFELFLLFIPLAGFLILAT
WRVLVGDPSGFLHTVSAIFCGWIMTVFALSHAAWLLMLPTTNIQGGALLVLFLLALTESN
DIAQYLWGKSCGRRKVVPKVSPGKTLEGLMGGVITTMIASMIIGPLLTPLNAWQALLAGL
LIGVSGFCGDVVMSAIKRDIGVKDSGKLLPGHGGLLDRIDSLIFTAPVFFYFIRYCCY
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaaaatctctggcaacacttttcgcgttgttaattttagcaacgctgataaac
cgttttctgatatggcggttaccggagggaaaagggggtgaggttacattacgtattcgt
acctggtggggcatcgtcatttgtttttcaatggtgatttcaggtccacgctggatgacg
ttgacgttttttgcgctgataagttttctggcattgaaagaatattgtacgcttatatcc
gtacattttccgcgttggttatattggggtattcctcttaactatttgcttatcggtttt
aattgctttgagctgtttctgttatttatacctttggctgggtttctgatattagccacc
tggcgagttttagtgggtgacccctctggttttctgcataccgtgagtgccattttttgt
ggctggataatgaccgttttcgccttgagtcatgccgcctggttattaatgttgccaacc
acaaatatccagggcggggcgttactggtgttatttcttttggcattaaccgagtcaaac
gatattgcacagtatttatggggaaaatcctgcggcagaagaaaagtggtccccaaagtc
agcccgggaaaaacactggaaggtctgatgggcggcgtaatcaccaccatgatagcgtcg
atgatcattggaccgttattgacacccttaaacgcctggcaggcattattggcggggtta
ctgattggggtaagtggtttttgcggcgatgtagtgatgtcagccatcaaacgagatatt
ggtgttaaagatagtggaaaactattaccaggacatggcggactccttgacaggattgac
tcattaattttcaccgctccggtatttttttattttattcgctactgctgttactga

DBGET integrated database retrieval system