KEGG   Escherichia coli APEC O1 (APEC): APECO1_1859Help
Entry
APECO1_1859       CDS       T00425                                 

Gene name
yadF
Definition
(GenBank) putative carbonic anhdrase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv00910  Nitrogen metabolism
ecv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    APECO1_1859 (yadF)
Enzymes [BR:ecv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     APECO1_1859 (yadF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-ProteinID: ABI99611
UniProt: A0A0H2YVJ4
LinkDB All DBs
Structure
PDB: 

Position
complement(148015..148677)
Genome map
AA seq 220 aa AA seqDB search
MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGEL
FVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWL
LHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWA
YGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHINHK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacatagatacactcatcagcaacaatgcactatggtcaaaaatgctggtggaa
gaggatcccgggttttttgagaaactggcacaagcgcaaaaaccgcgctttctatggatt
ggatgttccgacagtcgcgttcctgcagaacgtttaaccggtcttgagccgggcgaactc
tttgttcaccgtaatgttgctaacctggtcattcacaccgacctgaactgcctttccgtg
gttcagtatgcagtggatgtactcgaagttgaacacattattatctgtggccactacggt
tgcggcggcgtacaagccgcagttgaaaacccagaactggggcttatcaacaactggctg
ctgcatatccgcgatatctggttcaaacatagctcattgctcggcgaaatgccgcaagag
cgccgtctggataccttgtgtgaactgaacgtcatggaacaggtgtataacctgggccac
tccaccattatgcaatcagcgtggaaacgcgggcagaaagttaccattcacggctgggcc
tacggcattcacgacggcttgctgcgtgatctggatgtcacagcgactaaccgcgaaacc
cttgagcaacgttaccgtcacgggatctccaacctcaagctgaagcacatcaatcacaaa
taa

DBGET integrated database retrieval system