KEGG   Escherichia coli APEC O1 (APEC): APECO1_961Help
Entry
APECO1_961        CDS       T00425                                 

Gene name
fliY
Definition
(GenBank) cystine-binding periplasmic protein precursor
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
ecv  Escherichia coli APEC O1 (APEC)
Pathway
ecv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    APECO1_961 (fliY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecv02000]
    APECO1_961 (fliY)
   02035 Bacterial motility proteins [BR:ecv02035]
    APECO1_961 (fliY)
Transporters [BR:ecv02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    APECO1_961 (fliY)
Bacterial motility proteins [BR:ecv02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    APECO1_961 (fliY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1
Motif
Other DBs
NCBI-ProteinID: ABJ01261
UniProt: A0A0H2YZV2
LinkDB All DBs
Position
complement(2004558..2005415)
Genome map
AA seq 285 aa AA seqDB search
MFTNNGSTLQTDITTFGVNMKLAHLGRQALMGVMAVALVAGMSVKSFADEGLLNKVKERG
TLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRI
DVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYE
EWLRQNVQGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSR
QESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFGADVTK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgtttacaaacaatggctctacactgcaaacagacataacaacattcggggtaaatatg
aaattagcacatctgggacgtcaggcattgatgggtgtgatggccgtggcgctggttgcg
ggtatgagcgttaaaagttttgcagatgaaggtctgcttaataaagtcaaagagcgcggc
acgctgctggtagggctggaaggaacttatccgccgttcagttttcagggggatgacggc
aaattaaccggttttgaagtggaatttgcccaacagctggcaaaacatcttggcgttgag
gcgtcactaaaaccgactaaatgggacggtatgctggcgtcgctggactctaaacgcatt
gatgtggtgattaaccaggtcaccatttctgacgagcgcaagaaaaaatacgatttctct
accccgtacaccatttccggtattcaggcgctggtgaaaaaaggtaacgaaggcaccatt
aaaacggctgatgatctgaaaggcaaaaaagtgggtgtcggtctgggcaccaactatgaa
gagtggctgcgtcagaatgttcagggcgtggatgtgcgtacctatgatgatgacccgacc
aaatatcaggatctgcgcgtaggccgtatcgatgcgatcctcgttgatcgtctggcggcg
ctggatctggtgaagaaaaccaacgatacgctggcagtaaccggtgaagcattctcccgt
caggagtctggcgtggcgctgcgtaaaggaaatgaagacctgctgaaagcggtgaatgat
gcaattgcggaaatgcaaaaagatggcactttgcaagccctttccgaaaaatggtttggt
gctgatgtgaccaaataa

DBGET integrated database retrieval system